Protein Info for ABZR87_RS03790 in Ralstonia sp. UNC404CL21Col

Annotation: EamA family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 32 to 51 (20 residues), see Phobius details amino acids 60 to 82 (23 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 115 to 134 (20 residues), see Phobius details amino acids 141 to 162 (22 residues), see Phobius details amino acids 170 to 193 (24 residues), see Phobius details amino acids 205 to 229 (25 residues), see Phobius details amino acids 241 to 260 (20 residues), see Phobius details amino acids 266 to 286 (21 residues), see Phobius details PF00892: EamA" amino acids 6 to 131 (126 residues), 47 bits, see alignment E=1.5e-16 amino acids 144 to 283 (140 residues), 61.4 bits, see alignment E=5.3e-21

Best Hits

KEGG orthology group: K03298, drug/metabolite transporter, DME family (inferred from 99% identity to rpf:Rpic12D_3131)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (295 amino acids)

>ABZR87_RS03790 EamA family transporter (Ralstonia sp. UNC404CL21Col)
MSPKDLLLALTVVLVWGVNFVVIKVGLHGVPPMLLGALRFALVAFPAVLFVPRPKIALKW
LVAYGATISFGQFAFLFSAMYVGMPAGLASLVLQSQAFFTLTIAAIVLREPIRWFHLAGM
AVAAGGLAVIGMAGGGSVTGMTTAGFLLTLCAAFSWASGNIVTKRVGPVNVVSLVVWGAV
IPPVPFFLLSYWLEGPEQIAHSLANISASSIGAIVYLSFGATIFGYSLWSRLLARYAASQ
VAPLTLLVPVVGLVSAAVLLGERLVAAQWLGGAVVMAGLLLNVFGGRLAARRAMA