Protein Info for ABZR87_RS03525 in Ralstonia sp. UNC404CL21Col

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 662 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 339 to 358 (20 residues), see Phobius details PF17201: Cache_3-Cache_2" amino acids 48 to 334 (287 residues), 250.6 bits, see alignment E=7.6e-78 PF17202: sCache_3_3" amino acids 118 to 226 (109 residues), 99.3 bits, see alignment E=5.4e-32 PF17203: sCache_3_2" amino acids 132 to 226 (95 residues), 32 bits, see alignment E=4.3e-11 PF08269: dCache_2" amino acids 225 to 329 (105 residues), 40.9 bits, see alignment E=5.2e-14 PF17200: sCache_2" amino acids 227 to 332 (106 residues), 34.2 bits, see alignment E=8.1e-12 PF00672: HAMP" amino acids 358 to 406 (49 residues), 50.3 bits, see alignment 8.8e-17 PF00015: MCPsignal" amino acids 472 to 628 (157 residues), 178 bits, see alignment E=5.4e-56

Best Hits

KEGG orthology group: None (inferred from 97% identity to rpi:Rpic_3412)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (662 amino acids)

>ABZR87_RS03525 methyl-accepting chemotaxis protein (Ralstonia sp. UNC404CL21Col)
MRASAPLSEVSQSPTSLGTRLAVIGLIALVAVFGMFALANSQSSLRMLEANTQSAMHNQE
AAMRDMISLFDGTMRTEADRFLTAFADAAPGPYSVDPAQTVEVAGKPTPTFKSGDSVLNL
NFTVPDKFFARTGGTIATVFARTGDDFVRVTTSLKKENGERAIGTLLDRAHPSYKALMAG
EPFRGLAWLFGVPYMSKYEPVRDASGKVIGALYVGVDVRSELALLKDKIRSHGIGKTGGY
FVIDGKPGAEQGKVLIDHAQDREGKNLLDAKDAGGQAWVREMIARKDGTLRHVLADTEGG
TARERLTVFTQYPDWQLVIAGTAYVDELNADLVAARNRFLLLGLALGALLAGGLYWMLRR
AVSTPLAEVVNVAQRVAAGDLTHRLPTTRRDEIGQVMRAVNGVGDGLSGIVDKVRASAST
IASSTGQIAAGNADLSARTEAQAGNLERTASSIEQLAATVRQNAESAHHAHDMVQSASEA
ANAGGQTVERLVGTMSGIHATAQKIADITGIIDGIAFQTNILALNAAVEAARAGEQGRGF
AVVAGEVRSLAQRSAAAAKEIKELISRSVEEVQAGNEAARGAGDAMQDIVTRVERIAGLM
GEISHASREQSQGIEEVNRAVTSMDEVTQQNAALVEEAAAAAESLRQQAQELRGAVDVFR
LA