Protein Info for ABZR87_RS03505 in Ralstonia sp. UNC404CL21Col

Annotation: 2-hydroxyacid dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00389: 2-Hacid_dh
  • amino acids 3 to 329 (327 residues), 104.8 bits, E=4.3e-34
• PF02826: 2-Hacid_dh_C
  • amino acids 112 to 299 (188 residues), 193 bits, E=4.5e-61
• PF03446: NAD_binding_2
  • amino acids 148 to 258 (111 residues), 27.5 bits, E=4.5e-10

Best Hits

Swiss-Prot: 53% identical to DDH_HAEIN: 2-hydroxyacid dehydrogenase homolog (ddh) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K03778, D-lactate dehydrogenase [EC: 1.1.1.28] (inferred from 95% identity to rpi:Rpic_3406)

MetaCyc: 57% identical to D-lactate dehydrogenase (Escherichia coli K-12 substr. MG1655)
D-lactate dehydrogenase. [EC: 1.1.1.28]

Predicted SEED Role

"D-lactate dehydrogenase (EC 1.1.1.28)" in subsystem Fermentations: Lactate or Fermentations: Mixed acid (EC 1.1.1.28)

MetaCyc Pathways

• superpathway of glucose and xylose degradation (15/17 steps found)
• heterolactic fermentation (15/18 steps found)
• L-alanine degradation II (to D-lactate) (3/3 steps found)
• mixed acid fermentation (12/16 steps found)
• pyruvate fermentation to (R)-lactate (1/1 steps found)
• vancomycin resistance I (1/3 steps found)
• L-alanine degradation VI (reductive Stickland reaction) (2/6 steps found)
• superpathway of L-alanine fermentation (Stickland reaction) (4/9 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (4/9 steps found)
• lactate fermentation to acetate, CO₂ and hydrogen (Desulfovibrionales) (3/8 steps found)

KEGG Metabolic Maps

• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.28

Protein Sequence (331 amino acids)

>ABZR87_RS03505 2-hydroxyacid dehydrogenase (Ralstonia sp. UNC404CL21Col)
MRILFFSSHRYDEDSFRASLTRGGHGFDLVFQRAHLDAQTASLASGFEVVCPFVNDCLDA
DVLEALAAGGTRLIALRSAGFNHVDLPAAQRLGLTVVRVPAYSPHAVAEHAVGMILTLNR
RLHRACNRTREGDFSLDGLLGFDLAGKTVGVVGTGQIGQVFARIMAGFGCHVLAFDPFPQ
AALATQGVRYVPLPELLAQADIVSLHCPLNADTHHLIDANALASMKPGAMLINTSRGGLV
DSPALIDALKSGQLGHLGLDVYEEEADLFFEDRSADVLQDDVLARLLSFPNVIVTAHQAF
FTREALAGIADTTLANVAAWAAGAPVNVVKG