Protein Info for ABZR87_RS03450 in Ralstonia sp. UNC404CL21Col

Annotation: type II secretion system secretin GspD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 805 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details PF21305: type_II_gspD_N0" amino acids 56 to 125 (70 residues), 93.5 bits, see alignment E=8.5e-31 TIGR02517: type II secretion system protein D" amino acids 56 to 704 (649 residues), 637.3 bits, see alignment E=1.3e-195 PF03958: Secretin_N" amino acids 153 to 213 (61 residues), 54.3 bits, see alignment 1.9e-18 amino acids 216 to 297 (82 residues), 54.6 bits, see alignment E=1.6e-18 amino acids 304 to 434 (131 residues), 46.4 bits, see alignment E=5.6e-16 PF00263: Secretin" amino acids 532 to 699 (168 residues), 170.6 bits, see alignment E=3.6e-54

Best Hits

KEGG orthology group: K02453, general secretion pathway protein D (inferred from 96% identity to rpi:Rpic_3399)

Predicted SEED Role

"General secretion pathway protein D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (805 amino acids)

>ABZR87_RS03450 type II secretion system secretin GspD (Ralstonia sp. UNC404CL21Col)
MNETMYNASSRLTVRAIVLACCATMVAGSMPVFAAPPSAASSQNGAAGNPGDEVSLNFVN
ADLDSVVKAVGQATGKNFIVDPRVKGTVNLVTEKPVTRSQALESLGSILRMQGYAIVEGN
GFTKVVPEADAKLQGSPTSVGAAGARGGEQVVTQVFRLQHESANNLVPVLRPMIAPNNTI
TAYPANNTLVITDYADNLRRIGRIIASIDTPVAGETELIPLKNAVAIDVAATLQKLLDPS
AGGAGGAAGAGAALSDPSLRTSVVAEPRSNSVMVRASSAARLAQAKQLIAKLDVPNARPG
NIWVVPLKNANAVQLATTLRAIVAADATLSASASTGPGGQSAAQGATSQPAGGVSNLQNQ
NTQNTNYGSGSGSGSGSGGGSSSFRASFGQNNTPTTGGIIQADPATNALIITASEPVYRN
LRAVIDDLDARRAQVYIESMIVEVTATKASQLGIQWLVGGGGPGTFIGGGTNYGTGSGNL
ISLAGTIAAIGSGGIGGTAAQTALTSLNVGQLNGGNFGVFNRGSGLGVLLSALGSDGSVN
VLSTPNLITLDNEEAKILIGQNVPITTGSYAQTGTSASVSPFQTFDRKDVGITLRVKPQI
TDGGLVKMQIFQESSAVVPGTQNATQGPTTNVRSIETNVLANDGQVVVLGGLLEDNYQDG
EQKVPGLGDIPILGALFRSENKTRVKTNLLVFLRPIILRTADATGALSDNRYNYMRDTQQ
GFVSPNMLPTTSDKDTPVLPTPEAMRPADNYGDVSIVPKGPAGTQVPPGAPMPMPQGTTR
SQPRLQNFAAPTSGGYDGNAPRNGG