Protein Info for ABZR87_RS03435 in Ralstonia sp. UNC404CL21Col

Annotation: type II secretion system protein GspL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05134: T2SSL
  • amino acids 5 to 314 (310 residues), 164.9 bits, E=2e-52
• PF12693: GspL_C
  • amino acids 319 to 476 (158 residues), 114.2 bits, E=5.7e-37

Best Hits

KEGG orthology group: K02461, general secretion pathway protein L (inferred from 96% identity to rpf:Rpic12D_3049)

Predicted SEED Role

"General secretion pathway protein L"

Protein Sequence (478 amino acids)

>ABZR87_RS03435 type II secretion system protein GspL (Ralstonia sp. UNC404CL21Col)
MTTSLYVRLPHRPIQSPERWSAGALASVPFALVREEGALGAQRVQREGTSRTDELPAADR
LVLLLPAADVLLVPANVPPLALPKLRLALPNLVEDRLVQDAQQCHIALGPRLGDAPTRGW
RAPREPQSRALMIADRAWVRFILDTFAGHKHRTCHLLPAQLCVPFETPAAAAALIAASAN
AVERAEPSLDASAAAEPAVELPVADAVAAIAPATIALDAAPSSDPDAPVAVDITVRTGRA
EGYGLRLLPANVGNWLGIAPTPATLMVSPALRELAPGLSTDPTTATLDWSTWAAGARDAL
TSGEADLCQFDFARGGVAGMDWSLWRLPIALAVLIVVVQLIGMNARWLTLRAEQKRLDSA
MRAQLQTAFPNTPVILDPPAQMRRQVEQLRLAAGKSAPEDFLPLADRFAQAATGLAPDAL
LALDYHGRALTVTLKDGTDTASLRTAARNVGLNMDTAEAPRGAEATVPGSRWTVSIAQ