Protein Info for ABZR87_RS03400 in Ralstonia sp. UNC404CL21Col

Annotation: EF-hand domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13202: EF-hand_5
  • amino acids 64 to 79 (16 residues), 23.7 bits, see alignment (E = 7.5e-09)
  • amino acids 90 to 107 (18 residues), 24.9 bits, see alignment (E = 3.1e-09)
  • amino acids 129 to 147 (19 residues), 19.1 bits, see alignment (E = 2e-07)
  • amino acids 156 to 174 (19 residues), 24.5 bits, see alignment (E = 4e-09)
• PF13499: EF-hand_7
  • amino acids 86 to 149 (64 residues), 36.3 bits, E=1.8e-12
• PF13405: EF-hand_6
  • amino acids 152 to 178 (27 residues), 24 bits, see alignment (E = 6.4e-09)

Best Hits

KEGG orthology group: None (inferred from 96% identity to rpi:Rpic_3389)

Predicted SEED Role

"FIG00555715: hypothetical protein"

Protein Sequence (205 amino acids)

>ABZR87_RS03400 EF-hand domain-containing protein (Ralstonia sp. UNC404CL21Col)
MTNKRAVQAFLATSALFLAMSGMNARAQDASAPAASAQAPATAAAPAAPQNSARAGKPGH
HGGFKAIDTNGDGQISRDEAKGHAWLEKNFDQIDANHDGQLSKDELAAWHKAHKGEMHEK
MAQRFDAKFKAADKDNDGSLTKDEVQAGMPRLAKNFDQIDANHDGKITEDEIRAYMKARH
DARKAQMNTPAAAAMPGGPSATKGE