Protein Info for ABZR87_RS03320 in Ralstonia sp. UNC404CL21Col

Annotation: NAD(P)H-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 PF02525: Flavodoxin_2" amino acids 5 to 171 (167 residues), 164.4 bits, see alignment E=2.8e-52 PF03358: FMN_red" amino acids 48 to 119 (72 residues), 30.8 bits, see alignment E=2e-11

Best Hits

Swiss-Prot: 48% identical to KEFF_SALHS: Glutathione-regulated potassium-efflux system ancillary protein KefF (kefF) from Salmonella heidelberg (strain SL476)

KEGG orthology group: K11746, glutathione-regulated potassium-efflux system ancillary protein KefF (inferred from 97% identity to rpf:Rpic12D_3033)

Predicted SEED Role

"Glutathione-regulated potassium-efflux system ancillary protein KefF" in subsystem Glutathione-regulated potassium-efflux system and associated functions or Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (183 amino acids)

>ABZR87_RS03320 NAD(P)H-dependent oxidoreductase (Ralstonia sp. UNC404CL21Col)
MTSSRILVIYAHPAPRRSRANKPLARALASLPGVAMHDLYWHYPDFDIDVRIEQEAVEAA
ELIVFQFPVQWYATPSLLKEWIDVVLEMGWAYGPGGTALRGKHLMVLATTGGRAHSYNAD
GIHGHTFDMFLLPLQQTAALCGMQWQPPHVLHDADDASAETIDAHIAQVRAALQPWLPSD
ADA