Protein Info for ABZR87_RS03315 in Ralstonia sp. UNC404CL21Col

Annotation: glutathione-regulated potassium-efflux system protein KefC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 646 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 31 to 50 (20 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 87 to 109 (23 residues), see Phobius details amino acids 115 to 135 (21 residues), see Phobius details amino acids 147 to 171 (25 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details amino acids 216 to 235 (20 residues), see Phobius details amino acids 240 to 259 (20 residues), see Phobius details amino acids 271 to 290 (20 residues), see Phobius details amino acids 295 to 315 (21 residues), see Phobius details amino acids 327 to 348 (22 residues), see Phobius details amino acids 359 to 378 (20 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 11 to 375 (365 residues), 221.6 bits, see alignment E=1.6e-69 TIGR00932: transporter, monovalent cation:proton antiporter-2 (CPA2) family" amino acids 14 to 286 (273 residues), 287.2 bits, see alignment E=7.3e-90 PF02254: TrkA_N" amino acids 405 to 516 (112 residues), 91.1 bits, see alignment E=6.4e-30

Best Hits

KEGG orthology group: K11745, glutathione-regulated potassium-efflux system ancillary protein KefC (inferred from 98% identity to rpf:Rpic12D_3032)

Predicted SEED Role

"Glutathione-regulated potassium-efflux system protein KefC" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (646 amino acids)

>ABZR87_RS03315 glutathione-regulated potassium-efflux system protein KefC (Ralstonia sp. UNC404CL21Col)
MQSHDLLVNFVIYLAAAVAAVPLARRLGLGSVLGYLLAGVIVGPWGLRLITNVQSILDFS
EFGVVLMMFVIGLELEPARLWSLRRSIFGYGGLQLVVCALAVGLAVMVVGHPWRAAVVAG
LGLALSSTAIALATLTERNLMRTPAGTASFGILLFQDIAAIPMIALLPLLATDAGDASGG
HSWVAAAKAVGVVAAVIFGGRTLLRPVLRAIARTNMREMFTSFSLLLVVGIALLMHSVGL
SMALGAFIAGVLLADSEYRHALETDIEPFKGLLLGLFFLAVGMSIDFGVLMRQPWAVIGL
VAVFLAVKIGALRLLATRFGIARGQAWLFAFLLSQGGEFAFVVFGPGVAGNVLGDETAAA
LNLVVALSMAATPLLLLLHDKVLVPRMMDGKKRAPDAIEPQDNQVIIAGFGRFGQIVGRM
LYSQGYSATVLDHDPDQIDMLRRFGFKVFYGDATRMDLLETAGADKASMMVVAIDDMETN
LEVVDRVRERFPHLKLYVRARNVSHVYQLRDRGVEVIEREMFEGSLMLSRRVLEGLGKEP
YEAHRIAQTFRRHTLNSMEQVYPVYRDQKKLVSLAQQGRDELAEMFQRDRMQRKRLRESG
MPWGEGDVHSDVEDAQPDGDLANEVDGGDAETPIDCPARAGIRRDG