Protein Info for ABZR87_RS03250 in Ralstonia sp. UNC404CL21Col

Annotation: c-type cytochrome

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 19 to 42 (24 residues), see Phobius details PF00034: Cytochrom_C" amino acids 81 to 158 (78 residues), 26.7 bits, see alignment E=1.2e-09 amino acids 222 to 293 (72 residues), 32.5 bits, see alignment E=1.9e-11 PF13442: Cytochrome_CBB3" amino acids 81 to 156 (76 residues), 50.7 bits, see alignment E=1.9e-17 amino acids 219 to 292 (74 residues), 61.6 bits, see alignment E=7.5e-21

Best Hits

KEGG orthology group: None (inferred from 96% identity to rpi:Rpic_3367)

Predicted SEED Role

"Cytochrome c5"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>ABZR87_RS03250 c-type cytochrome (Ralstonia sp. UNC404CL21Col)
MSDAQHDEHEPLIKTPKQLIIAVIAAFAVPILIIILLANYVGLGAKEGAGGSGMSEEAVN
DRIKPVAQLELKDPNAPRVYKTGEQLYKEVCATCHAAGVAGAPKFGDAASWGPRLSQGLD
GLTKVALAGKGGMPARGGTSPDDVSDYEIERAIVYMANSAGGKLQEPAAPAGAGAAPAQA
AAPEASAPAAAQAPAAAAPAPAAAPAAPAAAAAPQAAAGEVGKKVYDSTCQMCHAAGVAG
APKFGDKAAWAPRIAEGKAKMYDIALHGKGAMPPKGTYAGSDEDVKAAVDYMAAAAK