Protein Info for ABZR87_RS03210 in Ralstonia sp. UNC404CL21Col

Annotation: NAD(P)/FAD-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 540 PF07992: Pyr_redox_2" amino acids 27 to 204 (178 residues), 33.8 bits, see alignment E=6.3e-12 PF00743: FMO-like" amino acids 29 to 365 (337 residues), 47.8 bits, see alignment E=2e-16 PF13450: NAD_binding_8" amino acids 30 to 96 (67 residues), 46 bits, see alignment E=1.3e-15 PF13738: Pyr_redox_3" amino acids 30 to 230 (201 residues), 53.6 bits, see alignment E=5.3e-18

Best Hits

Swiss-Prot: 60% identical to BVMO_PSEAE: Baeyer-Villiger monooxygenase (PA1538) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 99% identity to rpi:Rpic_3359)

Predicted SEED Role

"Cyclohexanone monooxygenase (EC 1.14.13.22)" (EC 1.14.13.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.22

Use Curated BLAST to search for 1.14.13.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (540 amino acids)

>ABZR87_RS03210 NAD(P)/FAD-dependent oxidoreductase (Ralstonia sp. UNC404CL21Col)
MNARTDFPRADAFASAPHNADAPPLIDAAIIGTGFAGLGMAIQLKQHGIDNFLVFEKAGS
VGGTWRDNHYPGCACDVQSHLYSFSFAPNPDWSRMYSPQPEIRAYLERCTDEFGVRPHVR
FHHELARAAFDDAAGVWNLEMADGRRYRARTLISGMGGLSRPAWPNIPGIETFQGKAFHS
QLWEHDYDLRGKRVAVIGTGASTIQFVPQIAPKVGRLDLYQRTPPWILPKPDRKVSRAEH
WLFRHLPFTQKLMRTGIYWMLESRVLGFVIHPKLMKAVERMARGHIKRRIADPVLREKVT
PDYTIGCKRILISNDYYPALTRENVDVITSGIARVEPNAIVTTDGTRREVDCLIFGTGFH
ATDPFPRGVLLGSQGVDIVDMWDKHGAEAYLGTTVSGFPNFFMVVGPNTGLGHSSMVFMI
ESQVAYIVDALKSMRAHNVAAIDVRPDVQRRFNDGIQKRLSNAIWSAGGCVSWYLDPKTG
KNTTLWPGFTWQFRRATAHFRLADYRTRPMTVPKGVPLRVPARTVPAAQNTPNEEALDRV