Protein Info for ABZR87_RS03155 in Ralstonia sp. UNC404CL21Col

Annotation: mechanosensitive ion channel family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 757 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 157 to 177 (21 residues), see Phobius details amino acids 197 to 216 (20 residues), see Phobius details amino acids 226 to 250 (25 residues), see Phobius details amino acids 270 to 288 (19 residues), see Phobius details amino acids 300 to 323 (24 residues), see Phobius details amino acids 351 to 373 (23 residues), see Phobius details amino acids 385 to 403 (19 residues), see Phobius details amino acids 426 to 448 (23 residues), see Phobius details amino acids 468 to 490 (23 residues), see Phobius details amino acids 513 to 535 (23 residues), see Phobius details amino acids 541 to 560 (20 residues), see Phobius details PF21088: MS_channel_1st" amino acids 517 to 557 (41 residues), 37.4 bits, see alignment 2.1e-13 PF00924: MS_channel_2nd" amino acids 559 to 623 (65 residues), 56.1 bits, see alignment E=3.2e-19

Best Hits

KEGG orthology group: None (inferred from 97% identity to rpi:Rpic_3348)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (757 amino acids)

>ABZR87_RS03155 mechanosensitive ion channel family protein (Ralstonia sp. UNC404CL21Col)
MRTHFLFCTRRLWPLASFLFLLMAGVAHMADAAPVSFAKLAGLQTSTASASAPAADPVQT
RQSLDTVITLLNNDQQRTALVNELKQLRDGMSAQQKVQAEQAPGLLGAVASLIENGSLQA
DVEAGAPRYWLRRIEAASGNASLLVAPERRMPLVADFASTVGIWAAIAAGLLGLGWLIRR
VFGLTAGLGPHPTTRALLIDALRKIGPWAISFAVIMRLDRDASPGFVLALVLAYAIVWGA
IITAGVAMLFSLFSGSAHRRVAVEYLFKRGMWPIFLTASLGACGDALVDPRVALVLGGSL
SLLLATVCNVVSSLMLAVGALWARRPIGQLIANRPLELRSGEHTGNQVRRLLAAFWPVPV
LVLAGATVMATLTTPDNVDVVARRAVMTSLLLVAAFFLSALVRPRANWRSHLRLARSSPY
LERLKHFVGALIKLVIWIAFLELVLRVWGHTLVEVAHSSVNGKRIADALVGLIGTVFATW
LVWILLDTAILRALSPASARAQPSTRALTILPLLRNGLKVTLVVTASIGVLANLGVNVTP
LVAGAGVIGLAVGFGAQSLAQDFITGIFILMEDTISVGDVVDVGVATGSVINLTIRTVRL
RDGTGAVLSIPFSQIKTVRNLSRDYSFADFEVRVAMEAEPQQAIDLVRAAADQIAGEPRF
GYTLLGGAEIFGLDRFEGGAMIVKGRFKTRPQKQADVLRAFNVVLKDTFDKAGVPLAAPG
TVLRTSAALEAWMTRIGGSDERKVPPTAEPPAAGAPA