Protein Info for ABZR87_RS03080 in Ralstonia sp. UNC404CL21Col

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 transmembrane" amino acids 51 to 75 (25 residues), see Phobius details amino acids 85 to 107 (23 residues), see Phobius details amino acids 115 to 140 (26 residues), see Phobius details amino acids 161 to 178 (18 residues), see Phobius details amino acids 185 to 208 (24 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details amino acids 274 to 293 (20 residues), see Phobius details amino acids 303 to 322 (20 residues), see Phobius details amino acids 329 to 353 (25 residues), see Phobius details amino acids 366 to 389 (24 residues), see Phobius details amino acids 396 to 417 (22 residues), see Phobius details PF00083: Sugar_tr" amino acids 17 to 220 (204 residues), 88.7 bits, see alignment E=4.2e-29 amino acids 214 to 418 (205 residues), 47.3 bits, see alignment E=1.5e-16 PF07690: MFS_1" amino acids 19 to 368 (350 residues), 104.4 bits, see alignment E=6.4e-34 amino acids 276 to 424 (149 residues), 39.9 bits, see alignment E=2.6e-14

Best Hits

Swiss-Prot: 65% identical to CITA_SALTY: Citrate-proton symporter (citA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 100% identity to rpf:Rpic12D_2992)

MetaCyc: 65% identical to propane-1,2,3-tricarboxylate-proton symporter (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN1R65-49

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (433 amino acids)

>ABZR87_RS03080 MFS transporter (Ralstonia sp. UNC404CL21Col)
MHTSNPNESKARTVFRVVSGNFLEMYDFMVYGYYAKAIADTFFPAGNEFLSLMLSLVTFG
AGFLMRPLGAIFLGAYIDRHGRRTGLIVTLALMACGTLLIALVPGYATIGLAAPLLVLIG
RLLQGFSAGVELGGVSVYLAEIATPGKKGFFVSWQSASQQVAVMFAALLGVLMSYLLPPS
EMSAWGWRVPFLIGCLIVPFLFIIRRSLQETEEFQKRKHRPDLRAVFRSMGQNWRLVGAG
TLMVVMTTVSFYLITAYTPTFGKSVLHLSDMDSLIVTLCVGASNFFWLPVMGAVSDRVGR
RPLLILFTVLMLVTAYPAMQWLVSAPSFARMLIVLLWLSFLYGSYNGAMVVTLTEIMPPE
VRTTGFSLAYSLATAIFGGFTPAIATWLIHETGNKAMPGVWVSFAALCGLIATLAIVKPA
GRHEHGAGTAPVA