Protein Info for ABZR87_RS02840 in Ralstonia sp. UNC404CL21Col

Annotation: 50S ribosomal protein L3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 TIGR03625: 50S ribosomal protein uL3" amino acids 4 to 206 (203 residues), 289.4 bits, see alignment E=7.8e-91 PF00297: Ribosomal_L3" amino acids 62 to 185 (124 residues), 58.4 bits, see alignment E=3.3e-20

Best Hits

Swiss-Prot: 100% identical to RL3_RALPJ: 50S ribosomal protein L3 (rplC) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K02906, large subunit ribosomal protein L3 (inferred from 100% identity to rpf:Rpic12D_2950)

MetaCyc: 62% identical to 50S ribosomal subunit protein L3 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L3p (L3e)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (217 amino acids)

>ABZR87_RS02840 50S ribosomal protein L3 (Ralstonia sp. UNC404CL21Col)
MSLGLVGRKVGMTRIFTDDGDSIPVTVLEVGDNRVTQIKTDETDGYTAVQVTFGTRRASR
VTKPLAGHLAKAGVEAGEVIKEFRVDAARAAEFQPGANISVDLFEVGQKIDVQGVTIGKG
YAGTIKRYNFSSGRASHGNSRSHNVPGSIGMAQDPGRVFPGKRMTGHMGDVTRTVQNLEI
AKIDAERKLLLVKGAIPGAKGGQVIVTPAVKARAKKA