Protein Info for ABZR87_RS02810 in Ralstonia sp. UNC404CL21Col
Annotation: 30S ribosomal protein S3
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to RS3_RALPJ: 30S ribosomal protein S3 (rpsC) from Ralstonia pickettii (strain 12J)
KEGG orthology group: K02982, small subunit ribosomal protein S3 (inferred from 99% identity to rpf:Rpic12D_2944)MetaCyc: 62% identical to 30S ribosomal subunit protein S3 (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"SSU ribosomal protein S3p (S3e)" in subsystem Ribosome SSU bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (262 amino acids)
>ABZR87_RS02810 30S ribosomal protein S3 (Ralstonia sp. UNC404CL21Col) MGQKIHPTGFRLAVSRNWASRWYASNTQFAGMLKEDIEVREFLKKKLKNASVGRVVIERP AKNARITIYSSRPGVVIGKKGEDIELLKAELQRRMGVPVHVNIEEIRKPEVDAQLIADSI TQQLERRIMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIARTEWYREGRVPLHTLRA DIDYGFSEAETTYGIIGVKVWVYKGDHLGRNDAPVVEEPQEERRKRPGRPEGRRREGEGR PAGQRRGAGAGARRGADAKTGE