Protein Info for ABZR87_RS02670 in Ralstonia sp. UNC404CL21Col

Annotation: c-type cytochrome biogenesis protein CcsB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 transmembrane" amino acids 29 to 47 (19 residues), see Phobius details amino acids 56 to 73 (18 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 122 to 143 (22 residues), see Phobius details amino acids 155 to 172 (18 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details amino acids 218 to 236 (19 residues), see Phobius details amino acids 261 to 281 (21 residues), see Phobius details amino acids 301 to 324 (24 residues), see Phobius details amino acids 338 to 355 (18 residues), see Phobius details amino acids 365 to 386 (22 residues), see Phobius details TIGR03144: cytochrome c-type biogenesis protein CcsB" amino acids 156 to 393 (238 residues), 248.8 bits, see alignment E=3.4e-78 PF01578: Cytochrom_C_asm" amino acids 187 to 390 (204 residues), 167 bits, see alignment E=2.4e-53

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpi:Rpic_3263)

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcsA/ResC" in subsystem Biogenesis of c-type cytochromes or Experimental tye

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (395 amino acids)

>ABZR87_RS02670 c-type cytochrome biogenesis protein CcsB (Ralstonia sp. UNC404CL21Col)
MEATNPQTTVASADLGALQRPSYFRRLGWFDWLFAAMLAAGAGYAFSRYGAYMDGYERGI
LVAAVPAFAWLGWTWKPVRVLMIGIAVLSLFGISQYAGANGPDLARAEHAFFLKYFLASQ
SAILWMSALIFLSTLFFWTGLALRWEAGGAIGSKLCWAAVVLGLTGMLVRWYESYLVGAD
IGHIPISNLYEVFILFTLITSLFYLYYEQRYKTRALGPFVMLVVSAAVGFLLWYTVSRGA
QEIQPLVPALQSWWMKIHVPANFIGYGTFALSAMVGSAYLLKERGVLADRLPSLEVLDDV
MYKAITVGFAFFTIATILGALWAADAWGGYWSWDPKETWALIVWLNYAAWLHMRLMKGLR
GRMAAWWALIGLLVTTFAFLGVNMFLSGLHSYGEL