Protein Info for ABZR87_RS02600 in Ralstonia sp. UNC404CL21Col

Annotation: temperature dependent type IV pilus secretin PilQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 718 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details PF11741: AMIN" amino acids 64 to 146 (83 residues), 41.1 bits, see alignment E=3.1e-14 amino acids 177 to 279 (103 residues), 86.1 bits, see alignment E=3.2e-28 TIGR02515: type IV pilus secretin PilQ" amino acids 291 to 711 (421 residues), 520.2 bits, see alignment E=2.3e-160 PF07660: STN" amino acids 317 to 363 (47 residues), 33.7 bits, see alignment 5.2e-12 PF03958: Secretin_N" amino acids 389 to 467 (79 residues), 52.8 bits, see alignment E=7.6e-18 PF00263: Secretin" amino acids 557 to 711 (155 residues), 171.7 bits, see alignment E=2.2e-54

Best Hits

KEGG orthology group: K02666, type IV pilus assembly protein PilQ (inferred from 98% identity to rpf:Rpic12D_2902)

Predicted SEED Role

"Type IV pilus biogenesis protein PilQ" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (718 amino acids)

>ABZR87_RS02600 temperature dependent type IV pilus secretin PilQ (Ralstonia sp. UNC404CL21Col)
MRLVKGGLSQAARVARGGAVAWLSLCLFMVAGQAAAQQAAPAAAVSGNTIEKVEQATAGE
STVVTVTLKSAPTQKPVEFSTQQPARIAIDFFGASFAQGRANYQYGGKLLRSANVVQIGD
RTRVVLDLARQTQYKSEVRGNQYVLTLEAAPVAAAVAAPTFSAPAPVAGAERPAVRNVDF
RRGEDLAGRVVVDLSTANSAINIAQQGQNLVVDFVGATLPQSLRRRYDVSDFGTPVQAMR
ATDNGTGARLIIEPRGNWQYSSYQTDTQFVVEVRPTKEDPNKLISGPGYRGERLSLNFQN
IDVRSLLQVFADFTNLNIVTSDSVTGTLSLRLKDVPWDQALQIVLDSKGLASRRNGNVLW
VAPRGELATKEKAELESQQQVTELEPLRSQVFRLNYQSAGDVRNMLLGTGAAGGAGGAAG
GTTSRILSKRGSLTADTRTNQLFVSDIPSKLEEVQAFLLKIDIPVRQVMIEARIVEADDT
FSRNLGAKLGFASKTNGAGYGNTYTNVVSPVTQNATWDNSPAISFPANGINGVNAASVAV
SLFNAGAGRFLALELSALEADGRGKIVSSPRVVTADNIKALIEQGTEIPYQQATSSGATS
VQFKKANLKLEVTPKITPDGNIFLDVDVNKDSVGIQTTNGFAIDTKHVQTQVLVENGGTV
VIGGIYTQNERTDINKVPLLGDIPVLGNLFKSTNKINNRTELLVFLTPRVLSDQLSLK