Protein Info for ABZR87_RS02460 in Ralstonia sp. UNC404CL21Col

Annotation: phosphoribosyl-ATP diphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03188: phosphoribosyl-ATP diphosphatase
  • amino acids 5 to 99 (95 residues), 92.3 bits, E=8.6e-31
• PF01503: PRA-PH
  • amino acids 7 to 102 (96 residues), 63.7 bits, E=8.8e-22

Best Hits

Swiss-Prot: 98% identical to HIS2_RALPJ: Phosphoribosyl-ATP pyrophosphatase (hisE) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K01523, phosphoribosyl-ATP pyrophosphohydrolase [EC: 3.6.1.31] (inferred from 97% identity to rso:RSc2944)

Predicted SEED Role

"Phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31)" in subsystem Histidine Biosynthesis (EC 3.6.1.31)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Histidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.31

Protein Sequence (124 amino acids)

>ABZR87_RS02460 phosphoribosyl-ATP diphosphatase (Ralstonia sp. UNC404CL21Col)
MSDTLRRLGEVLESRKLANGGDPEKSYIARLFNKGDDAILKKIGEEATETVMAAKDARAA
GMTDEARSKVVYEVADLWFHTMVLLSHFGLTPDDVVSELARREGLSGLEEKALRKSQARD
AAGD