Protein Info for ABZR87_RS02440 in Ralstonia sp. UNC404CL21Col

Annotation: twin-arginine translocase subunit TatC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 transmembrane" amino acids 31 to 50 (20 residues), see Phobius details amino acids 81 to 103 (23 residues), see Phobius details amino acids 119 to 141 (23 residues), see Phobius details amino acids 168 to 193 (26 residues), see Phobius details amino acids 205 to 222 (18 residues), see Phobius details amino acids 228 to 249 (22 residues), see Phobius details TIGR00945: twin arginine-targeting protein translocase TatC" amino acids 21 to 238 (218 residues), 219.8 bits, see alignment E=2.1e-69 PF00902: TatC" amino acids 22 to 233 (212 residues), 234.6 bits, see alignment E=5.3e-74

Best Hits

Swiss-Prot: 50% identical to TATC_ECOL6: Sec-independent protein translocase protein TatC (tatC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03118, sec-independent protein translocase protein TatC (inferred from 100% identity to rpi:Rpic_3217)

MetaCyc: 50% identical to twin arginine protein translocation system - TatC protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-181

Predicted SEED Role

"Twin-arginine translocation protein TatC" in subsystem Cluster-based Subsystem Grouping Hypotheticals - perhaps Proteosome Related or Twin-arginine translocation system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (267 amino acids)

>ABZR87_RS02440 twin-arginine translocase subunit TatC (Ralstonia sp. UNC404CL21Col)
MSAAPLDPQESPEDGAQETFISHLVELRERIVKAGAGVLLIFLGLVYWAPDIFNLFSRPL
IQALPKNGHMIVTDVTGSFFVPMKVTLLAAFLIALPWVLYQIWRFVAPGLYTHEKRMIMP
LVVSTYVLFLCGVAFAYFLVFPTVFKVMAHYNAPLGAEMSTDIDKYLSFAMTTFLAFGIT
FEVPVVVMVLVRFGIVSLEKLRQARPYVVVGAFVIAAVVTPPDVMSQLLLAVPLWLLYEL
GLILAAIFIRNTTAPENNPEHLPVVKD