Protein Info for ABZR87_RS02385 in Ralstonia sp. UNC404CL21Col

Annotation: ubiquinol-cytochrome c reductase iron-sulfur subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF10399: UCR_Fe-S_N" amino acids 1 to 40 (40 residues), 25.7 bits, see alignment 6.1e-10 TIGR01416: ubiquinol-cytochrome c reductase, iron-sulfur subunit" amino acids 11 to 195 (185 residues), 202.4 bits, see alignment E=2.9e-64 PF00355: Rieske" amino acids 116 to 180 (65 residues), 35.3 bits, see alignment E=8.7e-13

Best Hits

KEGG orthology group: K00411, ubiquinol-cytochrome c reductase iron-sulfur subunit [EC: 1.10.2.2] (inferred from 100% identity to rpi:Rpic_3206)

Predicted SEED Role

"Ubiquinol-cytochrome C reductase iron-sulfur subunit (EC 1.10.2.2)" in subsystem Ubiquinone Menaquinone-cytochrome c reductase complexes (EC 1.10.2.2)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.10.2.2

Use Curated BLAST to search for 1.10.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (202 amino acids)

>ABZR87_RS02385 ubiquinol-cytochrome c reductase iron-sulfur subunit (Ralstonia sp. UNC404CL21Col)
MSDQQNVDKGRRNLLIATSVAGGVGGVAVAAPFVCTFAPSEKARAAGAPVEADVSDLAPG
QMKVVEWRGKPVWLLKRTPDMLESLKKTDNEVADPKSDVPFTMKTPDYCKNETRSRAEHK
DLLVVVGICSHLGCSPSGPFPAGANVQLAGDPGFVCPCHGSTFDLAGRVFKNKPAPQNLD
VPPYMFLSDTKLVIGKDEKGEA