Protein Info for ABZR87_RS02340 in Ralstonia sp. UNC404CL21Col

Annotation: Nramp family divalent metal transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 547 transmembrane" amino acids 47 to 64 (18 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 124 to 150 (27 residues), see Phobius details amino acids 158 to 175 (18 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details amino acids 224 to 247 (24 residues), see Phobius details amino acids 268 to 290 (23 residues), see Phobius details amino acids 319 to 345 (27 residues), see Phobius details amino acids 365 to 386 (22 residues), see Phobius details amino acids 393 to 413 (21 residues), see Phobius details amino acids 431 to 454 (24 residues), see Phobius details amino acids 460 to 479 (20 residues), see Phobius details amino acids 524 to 545 (22 residues), see Phobius details PF01566: Nramp" amino acids 71 to 425 (355 residues), 280 bits, see alignment E=1.4e-87

Best Hits

KEGG orthology group: None (inferred from 97% identity to rpi:Rpic_3164)

Predicted SEED Role

"Manganese transport protein MntH" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (547 amino acids)

>ABZR87_RS02340 Nramp family divalent metal transporter (Ralstonia sp. UNC404CL21Col)
MTQFASGIDAPPRHAALDDAHVGDIRGALGTIAHHDTGARHSWRARLRTLLAILGPGLIV
MVGDNDAGAFGTYTQAGQNYGTTLLWTLLLLIPVLYVNQEMVLRLGAVTRVGHARLIFAR
FGRFWGSFSVIDLFLVNALTLVTEFIGISLALEYLGIPRHWGVCAAAALVMLAASTGDFR
RFERFALVLVAGSLTLIPVFLMVHPPMGQVARHFFVPALPAGAPLAEVVLLIIAIVGTTV
APWQLFFQQSYVIDKRITARFIRYERADLWLGIVLVIAGAVAMIAFSAQAFHGTPEFGNY
TDALGTAQGLERHSGRWAGVLFAIALLDASIIGACAVSLSTAYAIGDVFAVRHSLHRKPT
EAKGFYAVYFGLTLLAAGLVLTPGVPLGLLTNAVQSLAGVLLPSATVFLLLLCNDKAVLG
PWTNGRAMNIFTGGVVAVLVMLSVILTAAVLFPGIGEFEIGAILLGGSLIAVVMSLVLWR
IERRTHRPPHPQRVSVLDRDHWTMPPLDHLTPARWTPLKRTWMFVLRGYLVVAAGLVLVR
IAGLLTQ