Protein Info for ABZR87_RS02335 in Ralstonia sp. UNC404CL21Col

Annotation: ubiquinol oxidase subunit II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01433: ubiquinol oxidase, subunit II
  • amino acids 6 to 229 (224 residues), 382.2 bits, E=3.5e-119
• PF00116: COX2
  • amino acids 139 to 210 (72 residues), 29.5 bits, E=6e-11
• PF06481: COX_ARM
  • amino acids 229 to 273 (45 residues), 61.8 bits, 4.4e-21

Best Hits

Swiss-Prot: 64% identical to CYOA_PSEAE: Cytochrome bo(3) ubiquinol oxidase subunit 2 (cyoA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02297, cytochrome o ubiquinol oxidase subunit II [EC: 1.10.3.-] (inferred from 98% identity to rpf:Rpic12D_2814)

MetaCyc: 66% identical to cytochrome bo terminal oxidase subunit II (Pseudomonas putida KT2440)
RXN0-5268 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit II (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

• NADH to cytochrome bo oxidase electron transfer I (2/2 steps found)
• glycerol-3-phosphate to cytochrome bo oxidase electron transfer (2/2 steps found)
• pyruvate to cytochrome bo oxidase electron transfer (2/2 steps found)
• succinate to cytochrome bo oxidase electron transfer (2/2 steps found)
• D-lactate to cytochrome bo oxidase electron transfer (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer II (1/2 steps found)
• proline to cytochrome bo oxidase electron transfer (1/2 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Protein Sequence (317 amino acids)

>ABZR87_RS02335 ubiquinol oxidase subunit II (Ralstonia sp. UNC404CL21Col)
MKRLLAASLPLLLAGCNLTVLDPKGMIAAEEKTLILVATGLMLLVVIPVIVLTLVFAWKY
RASNTKARYEPDWSHSNAIEAVVWLIPCLIIIVLGVITYKSTHALDPYKPIESDVKPITV
EAVSLDWKWLFIYPELKIATVNQLAFPANTPINFKITSDTVMNAFFIPQLGSQVYAMAGM
QTKLHLIANETGVFDGMSSNYSGSGFTGMKFKATAMTNEEFDAWVKQVRASSQNLTKEGY
AELSKPSEKVPPAAYASVDPSLYHSILHKYMGDSDKVLTLDEALEGANCTTATAEAATRP
LPVQSALPAPKSAAKNS