Protein Info for ABZR87_RS02325 in Ralstonia sp. UNC404CL21Col

Annotation: cytochrome o ubiquinol oxidase subunit III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00510: COX3
  • amino acids 26 to 211 (186 residues), 64.4 bits, E=8.1e-22
• TIGR02842: cytochrome o ubiquinol oxidase, subunit III
  • amino acids 34 to 213 (180 residues), 273 bits, E=7.7e-86

Best Hits

Swiss-Prot: 66% identical to CYOC_PSEAE: Cytochrome bo(3) ubiquinol oxidase subunit 3 (cyoC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02299, cytochrome o ubiquinol oxidase subunit III [EC: 1.10.3.-] (inferred from 99% identity to rpf:Rpic12D_2812)

MetaCyc: 62% identical to cytochrome bo terminal oxidase subunit III (Pseudomonas putida KT2440)
RXN0-5268 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit III (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

• NADH to cytochrome bo oxidase electron transfer I (2/2 steps found)
• glycerol-3-phosphate to cytochrome bo oxidase electron transfer (2/2 steps found)
• pyruvate to cytochrome bo oxidase electron transfer (2/2 steps found)
• succinate to cytochrome bo oxidase electron transfer (2/2 steps found)
• D-lactate to cytochrome bo oxidase electron transfer (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer II (1/2 steps found)
• proline to cytochrome bo oxidase electron transfer (1/2 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Protein Sequence (213 amino acids)

>ABZR87_RS02325 cytochrome o ubiquinol oxidase subunit III (Ralstonia sp. UNC404CL21Col)
MASNVLDGHAAHGHAHGHDHAHDHAHHHDAADTKVFGFWVYLMSDLIIFASLFATFCVLR
GATAGGPTGKELFDLSYVAIETGILLVSSITYGMVMISLQNGRKDQVMLWLGITLLLGAA
FVGMEINEFHHLIAEGAGPSRSAFLSSFFLLVGTHGLHVASGMLWIIVLMWQISRKGLTP
TQSTRLSCLSLFWHFLDVVWIGVFTVVYLLGAM