Protein Info for ABZR87_RS02235 in Ralstonia sp. UNC404CL21Col

Annotation: response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 652 PF00072: Response_reg" amino acids 7 to 107 (101 residues), 54.7 bits, see alignment E=3.2e-18 amino acids 527 to 634 (108 residues), 73 bits, see alignment E=6.8e-24 TIGR00229: PAS domain S-box protein" amino acids 137 to 261 (125 residues), 53.3 bits, see alignment E=1.5e-18 PF00989: PAS" amino acids 142 to 253 (112 residues), 44.5 bits, see alignment E=4.2e-15 PF08448: PAS_4" amino acids 154 to 258 (105 residues), 38 bits, see alignment E=5.2e-13 PF13426: PAS_9" amino acids 154 to 256 (103 residues), 51.4 bits, see alignment E=3.3e-17 PF00512: HisKA" amino acids 277 to 338 (62 residues), 45 bits, see alignment E=2.8e-15 PF02518: HATPase_c" amino acids 390 to 502 (113 residues), 96.6 bits, see alignment E=3.7e-31

Best Hits

KEGG orthology group: None (inferred from 98% identity to rpf:Rpic12D_2795)

Predicted SEED Role

"FIG00974056: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (652 amino acids)

>ABZR87_RS02235 response regulator (Ralstonia sp. UNC404CL21Col)
MPNLQLLLVEDNPLDAELTRARLETANLPADTTLVDNETDFIAQLSARTFDAILADYMLP
QFTGAEALDIARRMAPQTPFIFVSGALGEEHAVDMLKRGATDYVIKQRLQRLPVVLLRAL
AEAAERRQRIAAEAALREAETHFRLLINALKEHAVLSLDPQGIVRTWNAASRSILGYARE
DILGKSAEILYPQAAREAGEFQRKLERVRREGSLTDDRWMLRKDGTPFYASSVVTAIHNE
TGQLVGFSKIIRDSTEERIAADALRRAKEEAETANHAKDHFLAVLSHELRTPLTPILTAV
HLLEMRQDLPAYVVAQLEVVRRNAELEARLIDDLLDITGIARGKLAVSFALVDLYPLLES
TLEMSRNDMQAKRLSLKTRFEAGRSRLYADGARIQQVIWNLVRNAVKFTPEGGAIEVRVW
NPSPSAVAVSVKDNGIGIEPEALPRIFSAFEQADASITQRFGGLGLGLAIAYALVQKHEG
SLIAESAGRHEGATFTLTLPLATEMAQPETPPSPPMPRKQPTRGLHVLLVEDNADTAEAM
SQMLEILGHSVTVANGARSAMQAAESGAFDLLISDIGLPDGSGLDVVRVFAERQAAPSIA
ITGYGMEDDIARCRDAGFTDHLTKPVDFKRLETLLAGYLAARDARTAGVDAS