Protein Info for ABZR87_RS02140 in Ralstonia sp. UNC404CL21Col

Annotation: anthranilate synthase component I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00564: anthranilate synthase component I
  • amino acids 25 to 498 (474 residues), 543.6 bits, E=2.2e-167
• PF04715: Anth_synt_I_N
  • amino acids 26 to 172 (147 residues), 114 bits, E=6.8e-37
• PF00425: Chorismate_bind
  • amino acids 221 to 490 (270 residues), 288.3 bits, E=5.9e-90

Best Hits

KEGG orthology group: K01657, anthranilate synthase component I [EC: 4.1.3.27] (inferred from 97% identity to rpf:Rpic12D_2758)

Predicted SEED Role

"Anthranilate synthase, aminase component (EC 4.1.3.27)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Tryptophan synthesis (EC 4.1.3.27)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• L-glutamate and L-glutamine biosynthesis (7/7 steps found)
• superpathway of chorismate metabolism (44/59 steps found)
• L-tryptophan biosynthesis (6/6 steps found)
• L-citrulline biosynthesis (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-glutamine degradation I (1/1 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• 4-hydroxy-2(1H)-quinolone biosynthesis (3/5 steps found)
• acridone alkaloid biosynthesis (1/4 steps found)
• superpathway of quinolone and alkylquinolone biosynthesis (3/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.27

Use Curated BLAST to search for 4.1.3.27

Protein Sequence (509 amino acids)

>ABZR87_RS02140 anthranilate synthase component I (Ralstonia sp. UNC404CL21Col)
MTELEFKSLADQGYNRIPLIAEALADLETPLSLYLKLAQSHDRGTHTFLLESVVGGERFG
RYSFIGLHACTLLRVKGNRTEVVTDGKVVETNEGNPLDFIAAFERRQKVALRPGLPRFCG
GLAGYFGYDAVRFIEPRLAETAPPDDLQLPDIQLMLCEELAVIDNLSGKLYLIVYADPSK
PEAYSHAKQRLRALRTKLHQPVDVPVTSPSVRTDTIREFDKADYITAVLKAKEYIAAGDM
MQVQIGQRLVKPFRDAPLSLYRALRSLNPSPYMYFYNFGDMQIVGASPEILVRQEERRIP
ASTNGNGADESARIVTIRPLAGTRPRGNTPERDAELATELLNDPKEIAEHVMLIDLARND
IGRIAEIGSVKVTDQMVIEKYSHVQHIVSSVEGRLKPGMTNMDVLRATFPAGTLSGAPKV
RAMEIIDELEPVKRGIYGGAVGYLSFSGEMDLAIAIRTGIIKDGNLYVQAAAGVVADSDP
DAEWRETEHKARAVLRAAEQVQDGLDADF