Protein Info for ABZR87_RS02105 in Ralstonia sp. UNC404CL21Col

Annotation: hydroxyphenylacetyl-CoA thioesterase PaaI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00369: uncharacterized domain 1
  • amino acids 28 to 140 (113 residues), 92 bits, E=2.8e-30
• TIGR02286: phenylacetic acid degradation protein PaaD
  • amino acids 31 to 141 (111 residues), 157.2 bits, E=1.6e-50
• PF14539: DUF4442
  • amino acids 32 to 134 (103 residues), 36.9 bits, E=3.9e-13
• PF03061: 4HBT
  • amino acids 60 to 132 (73 residues), 51.7 bits, E=9.3e-18

Best Hits

Swiss-Prot: 44% identical to PAAI_ECOLI: Acyl-coenzyme A thioesterase PaaI (paaI) from Escherichia coli (strain K12)

KEGG orthology group: K02614, phenylacetic acid degradation protein (inferred from 97% identity to rpi:Rpic_3116)

MetaCyc: 44% identical to phenylacetyl-CoA thioesterase (Escherichia coli K-12 substr. MG1655)
3.1.2.-; 3.1.2.-

Predicted SEED Role

"Phenylacetic acid degradation protein PaaD, thioesterase"

Protein Sequence (155 amino acids)

>ABZR87_RS02105 hydroxyphenylacetyl-CoA thioesterase PaaI (Ralstonia sp. UNC404CL21Col)
MSVTETTLHDAQALAEAACKSMFDADACTRWLGMRVEAVAPGYARLSMAVRPEFLNGHRT
CHGGLIFTLADSAFAFACNSHNHNTVAAGCSVEFLRPAHGGETLTAEATEQVLSGRHGIY
DVRVTNQAGEVVAMFRGKSAQIRGQVIPVPGSPES