Protein Info for ABZR87_RS02050 in Ralstonia sp. UNC404CL21Col

Annotation: fructose-specific PTS transporter subunit EIIC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 571 transmembrane" amino acids 243 to 268 (26 residues), see Phobius details amino acids 280 to 306 (27 residues), see Phobius details amino acids 315 to 341 (27 residues), see Phobius details amino acids 361 to 389 (29 residues), see Phobius details amino acids 400 to 422 (23 residues), see Phobius details amino acids 439 to 463 (25 residues), see Phobius details amino acids 475 to 495 (21 residues), see Phobius details amino acids 501 to 521 (21 residues), see Phobius details amino acids 542 to 563 (22 residues), see Phobius details TIGR00829: PTS system, Fru family, IIB component" amino acids 114 to 196 (83 residues), 114.3 bits, see alignment E=2.5e-37 PF02302: PTS_IIB" amino acids 115 to 203 (89 residues), 72.4 bits, see alignment E=4e-24 TIGR01427: PTS system, Fru family, IIC component" amino acids 226 to 564 (339 residues), 451.7 bits, see alignment E=2e-139 PF02378: PTS_EIIC" amino acids 241 to 508 (268 residues), 52.3 bits, see alignment E=4.7e-18

Best Hits

Swiss-Prot: 70% identical to PTFBC_XANCP: PTS system fructose-specific EIIB'BC component (fruA) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K02769, PTS system, fructose-specific IIB component [EC: 2.7.1.69] K02770, PTS system, fructose-specific IIC component (inferred from 96% identity to rpf:Rpic12D_2745)

Predicted SEED Role

"PTS system, fructose-specific IIB component (EC 2.7.1.69) / PTS system, fructose-specific IIC component (EC 2.7.1.69)" in subsystem Fructose utilization (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (571 amino acids)

>ABZR87_RS02050 fructose-specific PTS transporter subunit EIIC (Ralstonia sp. UNC404CL21Col)
MANLLAILGADGRTARAMLAGAALRHAARESGYKLDVDVRGPDITSVVDTAALATAEAVV
WAGLSPDAAARHANPRTLEVTLDEVLADARAVLARVMQNASPAPESGVQARRIVAITSCP
TGIAHTFMAAEALTQAAGALGHTIHVETQGSVGAQNTLSADAIASADLVLIAADTQVDLS
RFAGKRVFRAGTKAAIHDGQALIRRAFDEAAVEASGAAQSTRTAGAAAEQQRTGPYKHLM
TGVSFMLPFVVAGGILIALAFALGGIYVTDASASHTLGGALFQIGAKSAFALMVPVLAGY
IAYSIASRPGIAPGMVGGMLAASLGAGFLGGIVAGFVAGYGTEALNRWLKLPRNLEGLKP
VLILPVLGCLLTGLVMLYVVGAPVAALLASLTTWLRGMQGANAVPLGALLGGMMAFDMGG
PINKAAYAFSTGLIGAQVYTPMAATMAAGMTPPLGIALAAWLFPSRFTPDERQAARATAV
LGLAFISEGAIPYAARDPFRVIPALVAGSACTGALSMLFGVELRVPHGGAFVLPIPNAVT
HLGGYVAALVAGTVVTAVLLAVMKRRVAEGA