Protein Info for ABZR87_RS01960 in Ralstonia sp. UNC404CL21Col

Annotation: UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01225: Mur_ligase
  • amino acids 32 to 103 (72 residues), 31 bits, E=4.1e-11
• TIGR01143: UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
  • amino acids 34 to 459 (426 residues), 422.6 bits, E=8.7e-131
• PF08245: Mur_ligase_M
  • amino acids 115 to 307 (193 residues), 138 bits, E=6.2e-44
• PF02875: Mur_ligase_C
  • amino acids 329 to 448 (120 residues), 73.5 bits, E=4.5e-24

Best Hits

KEGG orthology group: K01929, UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanine ligase [EC: 6.3.2.10] (inferred from 96% identity to rpf:Rpic12D_2728)

Predicted SEED Role

"UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanine ligase (EC 6.3.2.10)" in subsystem Methicillin resistance in Staphylococci or Peptidoglycan Biosynthesis (EC 6.3.2.10)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (11/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• Lysine biosynthesis
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.10

Protein Sequence (478 amino acids)

>ABZR87_RS01960 UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase (Ralstonia sp. UNC404CL21Col)
MSAATVMMHATDAAAWMAGAYLAGPDAAILRVTTDSRAVQPGDLFVALIGERFDAHDFLP
EVVARGAAAVLVSRAPAATLDVTNVAVLTVADTRIGLGQLAAGWRRQFPIPVVAVTGSNG
KTTVKEMISAIFAQAVGEDARLATAGNFNNDIGLPLTLFRLNAQHKLAVLELGMNHPGET
AVLAAIAQPTVAMINNAQREHQEFMVSVEAVAEEHAAVLAALPADGVAVYPRDAANGGEY
APVWQAAAGSRRVLDFGIEAGAVTGTVVDTAAGQRIDVQAPGQRFVITLPLLGLHNARNA
LAATACALAAGVAPAVIAHALGNFAPVKGRLQRKQGAHGGLVIDDTYNANPDSMRAAIDA
LVTLPAPRCLVLGDMGEVGSQGPAFHEEIGAYARAHGIDAVLATGELARHTVDAFGPGAQ
HFASAEDLIEHGLGAIAPAATVLVKGSRFMRMERIVEALVLKDPVADLPTGSNTQQQH