Protein Info for ABZR87_RS01925 in Ralstonia sp. UNC404CL21Col

Annotation: cell division protein FtsQ/DivIB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 signal peptide" amino acids 6 to 11 (6 residues), see Phobius details transmembrane" amino acids 12 to 31 (20 residues), see Phobius details PF08478: POTRA_1" amino acids 53 to 110 (58 residues), 52.5 bits, see alignment E=5e-18 PF03799: FtsQ_DivIB_C" amino acids 116 to 239 (124 residues), 68.6 bits, see alignment E=8.7e-23

Best Hits

Swiss-Prot: 53% identical to FTSQ_BURPS: Cell division protein FtsQ (ftsQ) from Burkholderia pseudomallei (strain K96243)

KEGG orthology group: K03589, cell division protein FtsQ (inferred from 99% identity to rpf:Rpic12D_2721)

Predicted SEED Role

"Cell division protein FtsQ" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>ABZR87_RS01925 cell division protein FtsQ/DivIB (Ralstonia sp. UNC404CL21Col)
MWHNTRLLNAVASALYALLALGALGVGAVWLMQRPMFQLQQVRVMPMAGSELRHVNVPSL
RANALPKLRGNFFSLNLDEARAAFESVPWVRRASVRRVWPNGLLVEVQEHEALGTWGGNE
SGKLVNTYGEVFVANLAEAEDDTDLVALAGPEGTEQDVVDKLETMTEWFKPMNVEPLSVT
LTDRYAWRARLSNGTVIELGRELNDDDRAALAARARRFVRAWPDVTKRWGGQIEYADLRY
PNGFAVRAAGVRFLTDAQAAVLAKGGKLPGTANGTSGAAKPKATLGGKPAANNKATRSTE
KTR