Protein Info for ABZR87_RS01845 in Ralstonia sp. UNC404CL21Col

Annotation: type IV-A pilus assembly ATPase PilB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 575 transmembrane" amino acids 440 to 458 (19 residues), see Phobius details TIGR02538: type IV-A pilus assembly ATPase PilB" amino acids 3 to 574 (572 residues), 766.9 bits, see alignment E=6.5e-235 PF05157: MshEN" amino acids 36 to 134 (99 residues), 51.4 bits, see alignment E=1.1e-17 PF00437: T2SSE" amino acids 184 to 464 (281 residues), 330.9 bits, see alignment E=5.1e-103

Best Hits

KEGG orthology group: K02652, type IV pilus assembly protein PilB (inferred from 100% identity to rpf:Rpic12D_2705)

Predicted SEED Role

"Type IV fimbrial assembly, ATPase PilB" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (575 amino acids)

>ABZR87_RS01845 type IV-A pilus assembly ATPase PilB (Ralstonia sp. UNC404CL21Col)
MTLGLALAQSRRIAPTLLTQLEQSAREKRTQLIDELVGSGIMSAHDLAVFVAGKYQMPLL
DLAQYKLDTVPAVLSANKHFAQLRLLPLGRRENRLILATSDPSDPKPIEELRQKMNVAIE
TVVVEHDKLVRQLSLANEAPAEIKSLFPKQEATQIEYDPGAAAATRRTTPDGIDDAPVVR
FLQKLFTEALLRGASDLHFEPFETFYRVRFRIDGILAQVAQPPLDIRDKIATRIKVLSRL
DISEKRVPQDGRMKLLITVPKDRKDKDNKETIERAIDFRVSTLPTLFGEKIVIRILESST
ERLDIDQLGYEPEQKQLLLDVIKRPYGMVLVTGPTGSGKTVSLYTFLNRLNQGDINISTA
EDPAEIQLPGINQVNVNDKAGLTFAAALKSFLRQDPDIIMVGEIRDLETADISIKAAQTG
HLVFSTLHTNDAPTTLTRLMNMGVAPFNIASSVLLITAQRLARRLCKECKKPGPLPKETL
LDAGFTEADLDGSWQPYHPVGCEVCNGSGYKGRVGIYQVMPITEAIQEIILTHGTALQIA
EQARKEGVLSLRESGLRKVKQGLTSLEEVLATTNQ