Protein Info for ABZR87_RS01810 in Ralstonia sp. UNC404CL21Col

Annotation: glutamate 5-kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01027: glutamate 5-kinase
  • amino acids 11 to 372 (362 residues), 433.9 bits, E=2.5e-134
• PF00696: AA_kinase
  • amino acids 12 to 240 (229 residues), 154 bits, E=5.8e-49
• PF01472: PUA
  • amino acids 283 to 357 (75 residues), 79.1 bits, E=1.9e-26

Best Hits

Swiss-Prot: 100% identical to PROB_RALPJ: Glutamate 5-kinase (proB) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K00931, glutamate 5-kinase [EC: 2.7.2.11] (inferred from 100% identity to rpi:Rpic_3064)

Predicted SEED Role

"Glutamate 5-kinase (EC 2.7.2.11) / RNA-binding C-terminal domain PUA" in subsystem Proline Synthesis (EC 2.7.2.11)

MetaCyc Pathways

• L-citrulline biosynthesis (7/8 steps found)
• L-proline biosynthesis I (from L-glutamate) (4/4 steps found)
• L-ornithine biosynthesis II (3/3 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-N^δ-acetylornithine biosynthesis (5/7 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.11

Protein Sequence (374 amino acids)

>ABZR87_RS01810 glutamate 5-kinase (Ralstonia sp. UNC404CL21Col)
MALHSLIADARRLVVKVGSSLVTNDGRGLDQAAIARWAAQIAALRAAGKEVVLVSSGAIA
EGMQRLGWAKRPKEIHELQAAAAVGQMGLAQVYESEFARHSIRTAQVLLTHGDLADRERY
LNARSTLLTLLSLGVVPIINENDTVVTDEIKFGDNDTLGALVTNLIEGDALIILTDQRGL
YTADPRKEPGARFVDEAQAGTPDLEQMAGGAGSSIGKGGMLTKILAAKRAAKSGAHTIIA
SGREADVLARLASGEAIGTQLRAPTGRMAARKQWMIDHLQLRGRVVLDAGAVEKLTAGGK
SLLPIGVTEVQGEFARGEVISCVDAAGREVARGLTNYSSAEARLIARKASSEIEAVLGYV
SAAELVHRDNLVLL