Protein Info for ABZR87_RS01780 in Ralstonia sp. UNC404CL21Col

Annotation: MarC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 40 to 59 (20 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 105 to 128 (24 residues), see Phobius details amino acids 134 to 155 (22 residues), see Phobius details amino acids 169 to 191 (23 residues), see Phobius details TIGR00427: membrane protein, MarC family" amino acids 5 to 190 (186 residues), 115.2 bits, see alignment E=1.7e-37 PF01914: MarC" amino acids 5 to 192 (188 residues), 176.8 bits, see alignment E=1.9e-56

Best Hits

Swiss-Prot: 47% identical to Y449_BUCAI: UPF0056 membrane protein BU449 (BU449) from Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)

KEGG orthology group: None (inferred from 100% identity to rpi:Rpic_3058)

Predicted SEED Role

"Multiple antibiotic resistance (MarC) -related proteins"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (197 amino acids)

>ABZR87_RS01780 MarC family protein (Ralstonia sp. UNC404CL21Col)
MEYTFLSATVLLVLITDPLGNIPIFISALRPVAPERRNRVVLREVGIAFVLLLVFMFFGE
SFLRMMSLTDMSLQIAGGIVLFLIALRMIFPREGAAESQPTGEPFIVPLAIPAIAGPSAM
ATVMLLVSQAPGRMWTWVGSLCATMAVCAVVLLSATHIQRLVGERTVMAFERLMGLILVA
ISVEMLLKGIRTFAHQL