Protein Info for ABZR87_RS01765 in Ralstonia sp. UNC404CL21Col

Annotation: cytochrome c biogenesis protein CcsA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 62 to 79 (18 residues), see Phobius details amino acids 85 to 109 (25 residues), see Phobius details amino acids 114 to 137 (24 residues), see Phobius details amino acids 153 to 178 (26 residues), see Phobius details amino acids 210 to 233 (24 residues), see Phobius details amino acids 246 to 265 (20 residues), see Phobius details amino acids 274 to 296 (23 residues), see Phobius details PF01578: Cytochrom_C_asm" amino acids 70 to 299 (230 residues), 89.2 bits, see alignment E=1.6e-29

Best Hits

KEGG orthology group: None (inferred from 94% identity to rpi:Rpic_3055)

Predicted SEED Role

"FIG001154: CcsA-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>ABZR87_RS01765 cytochrome c biogenesis protein CcsA (Ralstonia sp. UNC404CL21Col)
MAIVLYALTALLYGILASVAWARRGGLGTQAAAGAMAAGGQLPGSTVLVPPPPGAADTVP
SWWRWGLLAALVAHGLLLHETIFPASAMVFGFAYALSAMLWLGVGIFWIESLFFSLAGLG
LLVMPVALVGSLLPLAFPGTQILGYAASALFKLHFAIANVAYGLFTLAAFHAILMLAAER
RLHTINRPAQASWFSRWLDLLPPLLTLEKLLFRLIGAGFVLLTLTIASGVLFSEQLFHSA
FHFDHKNIFAVLSWAMFGGILVGRRFRGWRGRVALRWVMAAFAVLLLAYVGSRFVLEVIL
HRA