Protein Info for ABZR87_RS01750 in Ralstonia sp. UNC404CL21Col

Annotation: sigma-54 dependent transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 541 PF00072: Response_reg" amino acids 11 to 120 (110 residues), 87.3 bits, see alignment E=2e-28 PF00158: Sigma54_activat" amino acids 148 to 312 (165 residues), 227.5 bits, see alignment E=2e-71 PF14532: Sigma54_activ_2" amino acids 148 to 317 (170 residues), 89.4 bits, see alignment E=6.5e-29 PF07728: AAA_5" amino acids 169 to 287 (119 residues), 22.8 bits, see alignment E=2e-08 PF02954: HTH_8" amino acids 474 to 514 (41 residues), 58.3 bits, see alignment 1.3e-19

Best Hits

KEGG orthology group: K02667, two-component system, NtrC family, response regulator PilR (inferred from 97% identity to rpi:Rpic_3052)

Predicted SEED Role

"Type IV fimbriae expression regulatory protein PilR" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (541 amino acids)

>ABZR87_RS01750 sigma-54 dependent transcriptional regulator (Ralstonia sp. UNC404CL21Col)
MSKAAIVREPILVVDDEADLRELLEISLRRMGHDVVLASGLAEAREALSRQRFALVLTDM
RLGDGLGIELVRQLSATADRTPVAVITAYGSAENAVEALKAGAFDYIAKPLSLDQLRSLV
LNALGRQQRDPDPGNADLAERTNDLLPGHSAAMQEVRRSLMRLARSMAPVVISGESGSGK
ERAARAIHALSSRAARPFVAVNCGAIPENLMEAEFFGYVKGAFTGADSDRQGFFQAANGG
TLMLDEVADLPLTMQVKLLRALQERRVRKIGESREDPVDVRVVCASHQNLARLVAAGRFR
EDLFYRLNVLELRMPTLRERAEDVPVLAGVLLEQLASRYGDPRPKRLTRPALQQLCAYPF
PGNVRELENLLERAYAFAEGESIDVDDLGALGAEIERSPLFHRTREAQAAAAGNHPLTPS
PMAGWPDAVYMPAPVPSPMGMPQPLASPEPAPVARPAEPALPSVALPIDLPAYLESVERN
VILAALDQTGFNRTAAAKLLGLSFRQLRYRMQQLGIRDPRDVEASPGSVGEPAGNGLNGD
A