Protein Info for ABZR87_RS01675 in Ralstonia sp. UNC404CL21Col

Annotation: carbohydrate kinase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00294: PfkB
  • amino acids 25 to 290 (266 residues), 142.7 bits, E=8.2e-46

Best Hits

KEGG orthology group: K00856, adenosine kinase [EC: 2.7.1.20] (inferred from 98% identity to rpf:Rpic12D_2626)

Predicted SEED Role

"Sugar kinases, ribokinase family"

MetaCyc Pathways

• superpathway of purine nucleotide salvage (14/14 steps found)
• adenine and adenosine salvage VI (1/1 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.20

Protein Sequence (311 amino acids)

>ABZR87_RS01675 carbohydrate kinase family protein (Ralstonia sp. UNC404CL21Col)
MASVICGSVAYDTIMTFDGHFREHILPDKIHILNVSFLVPTMRREFGGCAGNIAYTLKML
GGEPIIMGTVGQDAGPYLDYLKKLGISTAHITEVPDTFTAQAMITTDRDNNQITAFHPGA
MSHSSINSVKNALPARLGLVGPDSREGMLHHATQFAESGVPFIFDLGQAMPLFDGADLRH
FVELASYVVVNDYEAQVMLSRTGYSAAELAQRVEAYIVTRGEEGAEIYAGGKQYTIPVVP
AERVVDPTGCGDAFRGGLLYGIENGLDWDTTGRLASLMGSLKIACQGPQNYGLPVDEIAR
RFESAFGYRYQ