Protein Info for ABZR87_RS01665 in Ralstonia sp. UNC404CL21Col

Annotation: DUF3426 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 transmembrane" amino acids 327 to 348 (22 residues), see Phobius details TIGR02098: MJ0042 family finger-like domain" amino acids 12 to 47 (36 residues), 60.4 bits, see alignment 5e-21 PF13719: zinc_ribbon_5" amino acids 13 to 46 (34 residues), 48.2 bits, see alignment (E = 1.1e-16) PF13717: zinc_ribbon_4" amino acids 14 to 45 (32 residues), 41.8 bits, see alignment (E = 1.3e-14) PF11906: DUF3426" amino acids 333 to 479 (147 residues), 140.8 bits, see alignment E=5.4e-45

Best Hits

KEGG orthology group: None (inferred from 88% identity to rpi:Rpic_3034)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (483 amino acids)

>ABZR87_RS01665 DUF3426 domain-containing protein (Ralstonia sp. UNC404CL21Col)
MATAPQAAPRLAARCPNCQTAFRVVADQLRLRGGLVRCGRCNHVFDGRDHLIELGAVVTP
AAPTAEAPQPPQSPEPAARVAPLAPSAAPEPEAPAASPAAEDDHGFGMTLIWEEDVPEEG
VAEVHLGEVEGATPVPDVPSTAPDTRPLPDEVPIEPEVEPAAEPTQETRPPEPPAPPADP
FHGLPPIRDLDDEEDAFAAAVPKQPSADLPVEPAITPAAAPAAPAVTTAAAAAVSAPAKL
EAEKHDSVWMRHETDPHTLFAPVPRRHGLARRTQAEPAGPTPQRTVTGAPRPRKVRGPNH
GVSAATLDFLRAAQAREQTRKTTGRRALARVAIGLLAVAAVLQLLFLARAEIARRVPSTR
PMLEAMCQPLHCTIAPPRDLDALQIESSQLQRQEGDASDQYVLTATLRNRAGGPIALPAI
ELVTTDLQDQLLSRRALLPSDYLNPSDSAYSKSGLPARAELPIRVRFQSQRPTANYRVLI
FYP