Protein Info for ABZR87_RS01650 in Ralstonia sp. UNC404CL21Col

Annotation: acetyl-CoA carboxylase biotin carboxyl carrier protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00531: acetyl-CoA carboxylase, biotin carboxyl carrier protein
  • amino acids 1 to 154 (154 residues), 194.7 bits, E=6.7e-62
• PF00364: Biotin_lipoyl
  • amino acids 82 to 154 (73 residues), 92.2 bits, E=1.4e-30

Best Hits

Swiss-Prot: 60% identical to BCCP_HAEIN: Biotin carboxyl carrier protein of acetyl-CoA carboxylase (accB) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02160, acetyl-CoA carboxylase biotin carboxyl carrier protein (inferred from 96% identity to rpi:Rpic_3031)

MetaCyc: 56% identical to biotin carboxyl carrier protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Biotin carboxyl carrier protein of acetyl-CoA carboxylase" in subsystem Fatty Acid Biosynthesis FASII

MetaCyc Pathways

• biotin-carboxyl carrier protein assembly (4/4 steps found)
• 3-hydroxypropanoate cycle (7/13 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (10/18 steps found)
• glyoxylate assimilation (5/13 steps found)
• superpathway of the 3-hydroxypropanoate cycle (7/18 steps found)

Protein Sequence (155 amino acids)

>ABZR87_RS01650 acetyl-CoA carboxylase biotin carboxyl carrier protein (Ralstonia sp. UNC404CL21Col)
MDLRKLKTLIDLVAESGISELEVTEGEGKVRIVKSAPQVVAPMQYAPMQMQAAPAVSAPA
AAAPAAVGAEAASPALPAGHIVTSPMVGTFYRSPSPGAAEFVKVGDTVKEGQTICIIEAM
KLLNEIEADKAGVIKEILIENGQAVEYGQPLFVIG