Protein Info for ABZR87_RS01605 in Ralstonia sp. UNC404CL21Col

Annotation: shikimate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00507: shikimate dehydrogenase
  • amino acids 21 to 293 (273 residues), 248.2 bits, E=4.2e-78
• PF08501: Shikimate_dh_N
  • amino acids 23 to 105 (83 residues), 73.2 bits, E=2.5e-24
• PF01488: Shikimate_DH
  • amino acids 128 to 215 (88 residues), 36.7 bits, E=6.4e-13
• PF18317: SDH_C
  • amino acids 260 to 285 (26 residues), 32.3 bits, see alignment (E = 9.8e-12)

Best Hits

Swiss-Prot: 58% identical to AROE_CUPTR: Shikimate dehydrogenase (NADP(+)) (aroE) from Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CIP 107171 / LMG 19424 / R1)

KEGG orthology group: K00014, shikimate dehydrogenase [EC: 1.1.1.25] (inferred from 97% identity to rpf:Rpic12D_2611)

Predicted SEED Role

"Shikimate 5-dehydrogenase I alpha (EC 1.1.1.25)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 1.1.1.25)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• chorismate biosynthesis I (7/7 steps found)
• superpathway of chorismate metabolism (44/59 steps found)
• chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.25

Use Curated BLAST to search for 1.1.1.25

Protein Sequence (305 amino acids)

>ABZR87_RS01605 shikimate dehydrogenase (Ralstonia sp. UNC404CL21Col)
MPSSFQEAILAAASAPPTDRYGVIGNPIAHSKSPTIHAAFAQQTGQLIRYDRIYAELIAF
DETVMTFVREGGRGLNVTVPFKLDAYAMSTSLSLRAESAGAVNTLKFDGEEIFGDNTDGV
GLMRDITHNIGNALAGERVLLLGAGGAARGVLLPLLEHKPARVFLANRTADRANKLVDRF
EVSAKLHEVELVGGGYDELAADDVFDVIINATASSLQAEVPPIPTTVFGPNALAYDMMYG
QRPTVFMEFARRNGARAWDGLGMLVEQAAESFFVWRDVRPDTAPVLLAMREGLQGEAAVA
ARAPR