Protein Info for ABZR87_RS01580 in Ralstonia sp. UNC404CL21Col

Annotation: CinA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 PF02464: CinA" amino acids 9 to 160 (152 residues), 200.8 bits, see alignment E=4.9e-64 TIGR00199: amidohydrolase, PncC family" amino acids 14 to 157 (144 residues), 156.3 bits, see alignment E=3.1e-50

Best Hits

Swiss-Prot: 53% identical to PNCC_ECOLI: Nicotinamide-nucleotide amidohydrolase PncC (pncC) from Escherichia coli (strain K12)

KEGG orthology group: K03743, (no description) (inferred from 99% identity to rpf:Rpic12D_2606)

MetaCyc: 53% identical to NMN aminohydrolase (Escherichia coli K-12 substr. MG1655)
Nicotinamide-nucleotide amidase. [EC: 3.5.1.42]

Predicted SEED Role

"C-terminal domain of CinA paralog, YdeJ"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.42

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (166 amino acids)

>ABZR87_RS01580 CinA family protein (Ralstonia sp. UNC404CL21Col)
MAESRALAQLAELVADTLHKRSLMMASAESCTGGLVSAAITDVSGSSAWFERGFVVYSNE
AKSQMLGVPAALIREHGAVSEPVAHAMAEGAVLNSRAQVAVAITGVAGPTGGTPDKPVGM
VCFGWSNRLQTRVETRHFKGDRKQVRLQAAEHALRGLLDFLDSAES