Protein Info for ABZR87_RS01550 in Ralstonia sp. UNC404CL21Col

Annotation: L-arabinose ABC transporter permease AraH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 transmembrane" amino acids 35 to 55 (21 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 88 to 106 (19 residues), see Phobius details amino acids 112 to 132 (21 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 178 to 200 (23 residues), see Phobius details amino acids 230 to 249 (20 residues), see Phobius details amino acids 265 to 295 (31 residues), see Phobius details amino acids 310 to 326 (17 residues), see Phobius details PF02653: BPD_transp_2" amino acids 64 to 324 (261 residues), 122.9 bits, see alignment E=7.2e-40

Best Hits

Swiss-Prot: 89% identical to ARAH_AZOBR: L-arabinose ABC transporter permease protein AraH (araH) from Azospirillum brasilense

KEGG orthology group: K10538, L-arabinose transport system permease protein (inferred from 98% identity to rpf:Rpic12D_2600)

MetaCyc: 54% identical to arabinose ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-2-RXN [EC: 7.5.2.12, 7.5.2.13]

Predicted SEED Role

"L-arabinose transport system permease protein (TC 3.A.1.2.2)" in subsystem L-Arabinose utilization (TC 3.A.1.2.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.12 or 7.5.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (336 amino acids)

>ABZR87_RS01550 L-arabinose ABC transporter permease AraH (Ralstonia sp. UNC404CL21Col)
MQTPSTESVPGGAPLAAPGIPSRVALTWELVNRSGIVVVFLLLFTALAFTVPGFVSSRNI
QGLLLSVTLIGSISVTMMFVLALGEVDLSVASIVAFAGVVASTLITATHSVVLGVGAGVL
AGGLVGLVNGVLVARYQINSLIVTLAMMEVVRGLAFITSNGDAVMISEESFFDLGGGSFL
GISYPIWSNIVGFALFGFLLKKTVFGKNVLAVGGNEEAALLAGLPVTRIKIAVFVLQGLV
TGFAGVMLASRMSLGDPKTSVGLELGVISACVLGGVSLTGGVATVSGVLVGVLIMGSVQN
AMSLMNVPTFYQYLIRGGILLLAVWFDRIRRNKRAS