Protein Info for ABZR87_RS01355 in Ralstonia sp. UNC404CL21Col

Annotation: NAD(P)(+) transhydrogenase (Re/Si-specific) subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 35 to 55 (21 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 142 to 165 (24 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details amino acids 211 to 231 (21 residues), see Phobius details amino acids 260 to 279 (20 residues), see Phobius details PF02233: PNTB" amino acids 7 to 483 (477 residues), 628.2 bits, see alignment E=4.9e-193

Best Hits

Swiss-Prot: 61% identical to PNTB_RHORU: NAD(P) transhydrogenase subunit beta (pntB) from Rhodospirillum rubrum

KEGG orthology group: K00325, NAD(P) transhydrogenase subunit beta [EC: 1.6.1.2] (inferred from 99% identity to rpf:Rpic12D_2562)

Predicted SEED Role

"NAD(P) transhydrogenase subunit beta (EC 1.6.1.2)" in subsystem Phosphate metabolism (EC 1.6.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.1.2

Use Curated BLAST to search for 1.6.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (486 amino acids)

>ABZR87_RS01355 NAD(P)(+) transhydrogenase (Re/Si-specific) subunit beta (Ralstonia sp. UNC404CL21Col)
MSMNLVTLLYLLASVCFIQALKGLSHPTTARRGNAFGMTGMAIAAVTTVALIYKLKAEMF
AGTESGASTGFILIFAGLVVGGGIGAYVARTVEMTKMPELVAAMHSLIGLAAVCIAVAAV
AEPSAFGITVAGDNVLPLGNRVELFIGTFVGAITFSGSVIAFGKLSGKYKFRLFQGAPVQ
FAGQHMLNLLLAVAILGFGILFFLSQSWLPFIIMTAIAFVLGVLIIIPIGGADMPVVVSM
LNSYSGWAAAGIGFSLNNPMLIIAGSLVGSSGAILSYIMCKAMNRSFFNVILGGFGSEAS
AGATAGGGGQQRPVKSGSPDDAAFLMGNAETVIIVPGYGLAVARAQHALKELTEKLSDKG
VTVKYAIHPVAGRMPGHMNVLLAEAEVPYDQVFEMEDINGEFGQADVVLVLGANDVVNPA
AKNDPKSPIAGMPILEAYKAKTIIVNKRSMNAGYAGLDNELFYMDKTMMVFGDAKKVVED
MVKSVE