Protein Info for ABZR87_RS01265 in Ralstonia sp. UNC404CL21Col

Annotation: sensor domain-containing diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 PF13185: GAF_2" amino acids 29 to 163 (135 residues), 61.2 bits, see alignment E=2e-20 PF01590: GAF" amino acids 30 to 162 (133 residues), 38.1 bits, see alignment E=3.3e-13 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 177 to 333 (157 residues), 136 bits, see alignment E=5.2e-44 PF00990: GGDEF" amino acids 178 to 331 (154 residues), 148 bits, see alignment E=3.2e-47

Best Hits

KEGG orthology group: None (inferred from 94% identity to rpf:Rpic12D_2544)

Predicted SEED Role

"Sensory box/GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (339 amino acids)

>ABZR87_RS01265 sensor domain-containing diguanylate cyclase (Ralstonia sp. UNC404CL21Col)
MSFAHPPLQNPATLLEIVRAQSEIAKLGTDLGAIMALVTERAQHLTCATGAVIELAGGDE
MVYRATSGLTETLLGLRLARKGSLSGLCVQTGEILQCTDSETDARVDREACRRVGLRSMV
VTPLRHLDTTVGVLKLVAPEVDAFGESDIGVLELMSELIAAAMFHAANAERDQLYLRATH
DALTDLPNRALFYDRLRQSIHLAQRAHGGLGVLNIDMDNLKLINDRHGHRAGDAAIRETA
QRMGRTARRSDTVARVGGDEFAVILPGIGARADAQAQSERLMEEVQQPYVFEGQPLDLRV
SIGMAVMPEDGTEITALLDQADREMYTVKRLRKQVQPAH