Protein Info for ABZR87_RS01115 in Ralstonia sp. UNC404CL21Col

Annotation: mechanosensitive ion channel family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 27 to 46 (20 residues), see Phobius details amino acids 65 to 90 (26 residues), see Phobius details amino acids 96 to 126 (31 residues), see Phobius details PF00924: MS_channel_2nd" amino acids 114 to 179 (66 residues), 68.3 bits, see alignment E=5e-23 PF21082: MS_channel_3rd" amino acids 198 to 265 (68 residues), 23.5 bits, see alignment E=6e-09

Best Hits

KEGG orthology group: K03442, small conductance mechanosensitive channel (inferred from 98% identity to rpi:Rpic_2898)

Predicted SEED Role

"Small-conductance mechanosensitive channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>ABZR87_RS01115 mechanosensitive ion channel family protein (Ralstonia sp. UNC404CL21Col)
MADNLADTAVNTASKYQAIVAQYATDVGMKILAAIVFWVVGRWLIHLAVRMVEGSLTRQK
VDPTVLRYVGSIITVTLNVLLVIGILGYFGIQTTTFAALIAAAGVAVGMAWSGLLSNFAA
GAFLIVLRPFKVGDFVTAGGVTGTIKEIGLFATTINTPDNVVTIVGNGKIFADTIQNYTS
NPFRRVELKAQLAGSADHRAAIALLKEKVAAIPNVLTDPAVDVEILEFNLVGPVLAVRPY
THNDNYWQVYFDTNRTIKEALAEAGFPAPTPSQALTITTPGQLAGLAAVAQSTTTPTIVN