Protein Info for ABZR87_RS01075 in Ralstonia sp. UNC404CL21Col

Annotation: MprA protease, GlyGly-CTERM protein-sorting domain-containing form

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 549 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 520 to 540 (21 residues), see Phobius details PF00082: Peptidase_S8" amino acids 167 to 461 (295 residues), 132.8 bits, see alignment E=8.1e-43 TIGR03867: MprA protease C-terminal rhombosortase-interaction domain" amino acids 521 to 545 (25 residues), 20.2 bits, see alignment (E = 3.3e-08)

Best Hits

KEGG orthology group: K14645, serine protease [EC: 3.4.21.-] (inferred from 88% identity to rpi:Rpic_2890)

Predicted SEED Role

"FIG00976385: hypothetical protein"

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (549 amino acids)

>ABZR87_RS01075 MprA protease, GlyGly-CTERM protein-sorting domain-containing form (Ralstonia sp. UNC404CL21Col)
MTPSLFRLKSWRRAGASLACLAWMVGGQVATAAAAATPQPQYTGDLIIKWRDDTSGTRKT
LSASEASNRLLSVAQAAGSTLQVKRTLATNAQLMHTGLTDAASIQATVNKIAQDARVAYV
VPDRILRPNTVPNDPLFATQNNLAAPALVPGGINAAAAWNITQGSTSIVVAVVDTGYTDH
PDLSSKILPGYNFISDPARAGNSFGRGTDAHDLGDGVTSTQWQNIPGCTSNDVGNSSWHG
TEVSSVLAAQTNNVLDIAGVGWNTPIVPVRVSGKCGALLSDTVDGMLWAGGINVSGVPAN
ANPARVVNVSLGSTTQCSAAEQDAVNQLAARGAIVVAAAGNEAAQTVDAPANCTGAIAVT
AHVDSGENASYANVGPQVALSAPGGGCGNSQATSAGCSGTTSVIQADSNDGTQSVGNPTV
KSVAGTSFSTPETAGTIALMLSVQPQLSNVQVLAGLKQTARPHPGGTFCAVNTGVCGAGL
LDAAGAVSYAQNTAPAGAGSGTSGSSGSTGSTGGTSSGGGGGGGAVPLIGAALLLALGLA
SRKRRPLSR