Protein Info for ABZR87_RS01060 in Ralstonia sp. UNC404CL21Col

Annotation: NAD kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01513: NAD_kinase
  • amino acids 75 to 137 (63 residues), 60 bits, E=3.1e-20
• PF20143: NAD_kinase_C
  • amino acids 163 to 285 (123 residues), 116.9 bits, E=5e-38

Best Hits

Swiss-Prot: 95% identical to NADK_RALSO: NAD kinase (nadK) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K00858, NAD+ kinase [EC: 2.7.1.23] (inferred from 98% identity to rpi:Rpic_2887)

Predicted SEED Role

"NAD kinase (EC 2.7.1.23)" in subsystem NAD and NADP cofactor biosynthesis global (EC 2.7.1.23)

MetaCyc Pathways

• cytosolic NADPH production (yeast) (4/5 steps found)
• NADP biosynthesis (1/1 steps found)
• superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (6/8 steps found)
• NAD phosphorylation and transhydrogenation (1/2 steps found)
• mitochondrial NADPH production (yeast) (3/5 steps found)
• NAD phosphorylation and dephosphorylation (1/3 steps found)
• NAD(P)/NADPH interconversion (3/6 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.23

Protein Sequence (312 amino acids)

>ABZR87_RS01060 NAD kinase (Ralstonia sp. UNC404CL21Col)
MSTSPSAVAPQAPAASPVSPFKTVALVGRYSAANIAGPLMELASCIAGRGHDIVFERETA
LNIGVQDYPALPPEEMARHADVAVVLGGDGTLLGIGRHLAGASVPVIGVNHGRLGFMTDI
PFDDVHTVLPDMLAGRYEAETRTLLQAQVVRDDEVIFSALAFNDVVVNRSGTSGMVELAV
SVDGFFMYNQRSDGLIVSTPTGSTAYALSAGGPILHPALSGLVLVPIAPHSLSNRPIVIP
HDAEVVIQVTSGRDASVNFDMQSLTSLLPGDRIVVRRSERTVRLLHPIGYNYYATLRKKL
HWHEYPTEDNRL