Protein Info for ABZR87_RS01050 in Ralstonia sp. UNC404CL21Col

Annotation: taurine ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF04069: OpuAC" amino acids 34 to 254 (221 residues), 47.3 bits, see alignment E=4.4e-16 TIGR01729: taurine ABC transporter, periplasmic binding protein" amino acids 35 to 339 (305 residues), 336.7 bits, see alignment E=6.9e-105 PF12974: Phosphonate-bd" amino acids 46 to 236 (191 residues), 58.7 bits, see alignment E=1.2e-19 PF13379: NMT1_2" amino acids 55 to 252 (198 residues), 34.8 bits, see alignment E=3.3e-12 PF09084: NMT1" amino acids 59 to 246 (188 residues), 61 bits, see alignment E=3.2e-20

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 98% identity to rpf:Rpic12D_2479)

Predicted SEED Role

"Taurine-binding periplasmic protein TauA" in subsystem Taurine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (354 amino acids)

>ABZR87_RS01050 taurine ABC transporter substrate-binding protein (Ralstonia sp. UNC404CL21Col)
MAGSSFSRLLAAAMSAAISFALFGAAPARAADREVVIAYQDMVLPWRYAQATGEVERATG
YKVTYRQLASGADVVRAIASGSVQIGEAGSSPIAAGVSQGVDLSLFWILDNINDAEALVA
RNGSGVLRVADLKGKTLGVPYVSTSHFHALVALQQAGLEPRDVKVVNLRPQELSAAWDRG
DVDAAFIWDPVLAKVKKNGTVLTTSGKIAAATGKSTFDGFVADRKFARDHAEFIAKFVEV
LSKADAAYRDNKAAWTATSPQVAAVAKTSGATAADVPASLALYAFPDAAEQASKRWLGGG
AQSGAAQSLLATAQFLKTQGTIQTVLPDYGATIDSRFVQRAANAGNKAVATAAR