Protein Info for ABZR87_RS01015 in Ralstonia sp. UNC404CL21Col

Annotation: imidazolonepropionase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 transmembrane" amino acids 280 to 298 (19 residues), see Phobius details TIGR01224: imidazolonepropionase" amino acids 32 to 409 (378 residues), 475.1 bits, see alignment E=6.9e-147 PF01979: Amidohydro_1" amino acids 69 to 410 (342 residues), 70.6 bits, see alignment E=1.5e-23 PF07969: Amidohydro_3" amino acids 118 to 411 (294 residues), 54.7 bits, see alignment E=1.3e-18

Best Hits

Swiss-Prot: 92% identical to HUTI_RALSO: Imidazolonepropionase (hutI) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K01468, imidazolonepropionase [EC: 3.5.2.7] (inferred from 96% identity to rpf:Rpic12D_2472)

MetaCyc: 62% identical to imidazolonepropionase (Pseudomonas fluorescens)
Imidazolonepropionase. [EC: 3.5.2.7]

Predicted SEED Role

"Imidazolonepropionase (EC 3.5.2.7)" in subsystem Histidine Degradation (EC 3.5.2.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (411 amino acids)

>ABZR87_RS01015 imidazolonepropionase (Ralstonia sp. UNC404CL21Col)
MTDPANPHWDALWTNVHLATLAADADGYGEIRDGAIAIKDGRIAWLGYRADLPANAHATR
EHDGGGAWLTPGLIDCHTHLVYAGNRSNEFEARLNGVPYEEIARAGGGILSTVRATRAAS
EDALADASLPRLNALRAEGVTTVEIKSGYGLNLETERCMLRVARRFGQSLPVRVRTTFLG
AHAVPPEFAGRADDYIDHLCADVLPALAAEGLVDAVDAFCETIGFTPAQTARMFDAAQRH
GLPVKLHAEQLSDQGGAALVARYGGLSADHLECLTEAGIAAMAQAGTVAVLLPGAFYCLR
ETRLPPMAALRAAGVPMAVSTDCNPGTSPLSSLLLAMNMACTLFRLTPLEALTGATRHAA
AGLGLSGTCGVLAPGCAADFALWRIDRPADLAYAMGLNPCVGVVKDGTVVA