Protein Info for ABZR87_RS00970 in Ralstonia sp. UNC404CL21Col

Annotation: molecular chaperone DnaJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 PF00226: DnaJ" amino acids 5 to 67 (63 residues), 99.3 bits, see alignment E=2.1e-32 TIGR02349: chaperone protein DnaJ" amino acids 5 to 356 (352 residues), 458.1 bits, see alignment E=1.2e-141 PF01556: DnaJ_C" amino acids 127 to 340 (214 residues), 176.1 bits, see alignment E=1e-55 PF00684: DnaJ_CXXCXGXG" amino acids 154 to 214 (61 residues), 63.9 bits, see alignment E=2.7e-21 PF27439: DnaJ_C_2" amino acids 347 to 381 (35 residues), 35 bits, see alignment 2.3e-12

Best Hits

Swiss-Prot: 99% identical to DNAJ_RALPJ: Chaperone protein DnaJ (dnaJ) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K03686, molecular chaperone DnaJ (inferred from 100% identity to rpf:Rpic12D_2463)

MetaCyc: 58% identical to chaperone protein DnaJ (Escherichia coli K-12 substr. MG1655)
1.8.4.-

Predicted SEED Role

"Chaperone protein DnaJ" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (382 amino acids)

>ABZR87_RS00970 molecular chaperone DnaJ (Ralstonia sp. UNC404CL21Col)
MAKRDYYEVLGVGKNASDDEIKKAYRKLAMKYHPDRNPDSKEAEEKFKEAKEAYEMLSDA
EKKAAYDQYGHAGVDPNMAGGFGAGGAGFGGGFAEAFGDIFGDIFGQAQGQGGRRGGGPQ
MYRGADLRYSMEITLEQAAHGYDTQIRVPHWDECDHCHGKGAEPGSSVETCPTCHGAGQV
RVSQGFFTMQQTCPKCHGSGKYIPKPCTKCHGQGKLKSQKTLEVKIPAGIDEGMRIRSSG
NGEPGINGGPPGDLYVEIHIKPHPVFERDGDDLHCQMPISFATAAIGGDIEVPTLGGRAS
FTVPEGTQAGKTFRLRGKGIKGVRSGYAGDLYVHINIETPVKLTEHQKELLKQFDKSVHE
GGSRHSPQEQSWMDKVKNFFSS