Protein Info for ABZR87_RS00955 in Ralstonia sp. UNC404CL21Col
Annotation: ABC transporter permease
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 42% identical to ANTRP_HALVD: Probable anion ABC transporter permease protein HVO_1887 (HVO_1887) from Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
KEGG orthology group: K05773, putative tungstate transport system permease protein (inferred from 99% identity to rpf:Rpic12D_2460)Predicted SEED Role
"ABC-type tungstate transport system, permease protein" in subsystem ABC transporter tungstate (TC 3.A.1.6.2)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (235 amino acids)
>ABZR87_RS00955 ABC transporter permease (Ralstonia sp. UNC404CL21Col) MEIWSATVDAFALLAGGDAALWRIVWVSLKVAIAGLLLAAPPGLLIAYLIAMHRFAGRRA LVVLAQASLSFPTVLIGLLLYLLLSRQGPLGGFGLLFTQGGMILGQAVLGLPVIVAFALT TLERADPRLAETARVLGAGRVRLLLTVFRELRFGLMAAVVAGFGRVIAEVGSALMVGGNI EGVTRTMTTAIALETSKGEFAQGIALGIVLIGLALLVNLVLAWLQGAGNYRREPA