Protein Info for ABZR87_RS00865 in Ralstonia sp. UNC404CL21Col

Annotation: VTT domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 transmembrane" amino acids 23 to 45 (23 residues), see Phobius details amino acids 65 to 86 (22 residues), see Phobius details amino acids 122 to 139 (18 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details amino acids 183 to 205 (23 residues), see Phobius details PF09335: VTT_dom" amino acids 45 to 169 (125 residues), 77.7 bits, see alignment E=5.6e-26

Best Hits

KEGG orthology group: K03975, membrane-associated protein (inferred from 99% identity to rpf:Rpic12D_2429)

Predicted SEED Role

"DedA protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (214 amino acids)

>ABZR87_RS00865 VTT domain-containing protein (Ralstonia sp. UNC404CL21Col)
MQLVDIVLHVDKSLGLLIQQYGAWVYVLLFAIVFAETGLVVLPFLPGDTLLFIAGAMCAT
GQMDAWLLIVLLVIAATTGNTVNYFVGSWIGPKVFDGHIRFLDHEALMKTHGFYERHGGK
TLVMARFIPVVRTFAPFVAGVSKMTFAKFQLFNMIGAVLWVAILVLSGEAFGNVPVIRDH
LNTIVLIGLGAAIVPLALGGLWKLLKRRRGVAPK