Protein Info for ABZR87_RS00840 in Ralstonia sp. UNC404CL21Col

Annotation: ornithine carbamoyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 PF02729: OTCace_N" amino acids 8 to 148 (141 residues), 169.2 bits, see alignment E=6.5e-54 TIGR00658: ornithine carbamoyltransferase" amino acids 8 to 304 (297 residues), 354.6 bits, see alignment E=2.1e-110 PF00185: OTCace" amino acids 154 to 303 (150 residues), 173.4 bits, see alignment E=3.7e-55

Best Hits

Swiss-Prot: 99% identical to OTC_RALPJ: Ornithine carbamoyltransferase (arcB) from Ralstonia pickettii (strain 12J)

KEGG orthology group: None (inferred from 99% identity to rpi:Rpic_2830)

MetaCyc: 44% identical to ornithine carbamoyltransferase (Arabidopsis thaliana col)
Ornithine carbamoyltransferase. [EC: 2.1.3.3]

Predicted SEED Role

"Ornithine carbamoyltransferase (EC 2.1.3.3)" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 2.1.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (308 amino acids)

>ABZR87_RS00840 ornithine carbamoyltransferase (Ralstonia sp. UNC404CL21Col)
MNPPSSIKHYLQFKDFSLEEYEYLLDRSAILKAKFKNYETWHPLHDRTLAMIFEKNSTRT
RLSFEAGIHQLGGHAVFLNTRDSQLGRGEPIEDAAQVISRMTDIIMIRTFGQEIIERFAA
HSRVPVINGLTNEYHPCQVLADIFTFIEHRGPIKGKTVTWVGDANNMAYTWIQAAEILGF
RFHFSAPKGYQLDPAMVADSALPFVHVFESPLEACDGAHLVTTDVWTSMGYEAENEARKK
AFGDWMVTEAMMQRAQPDALFMHCLPAHRGEEVEAAVIDGKQSVVWDEAENRLHVQKALM
EYLLCGRY