Protein Info for ABZR87_RS00840 in Ralstonia sp. UNC404CL21Col

Annotation: ornithine carbamoyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02729: OTCace_N
  • amino acids 8 to 148 (141 residues), 169.3 bits, E=6.2e-54
• TIGR00658: ornithine carbamoyltransferase
  • amino acids 8 to 304 (297 residues), 354.6 bits, E=2.1e-110
• PF00185: OTCace
  • amino acids 154 to 302 (149 residues), 172.6 bits, E=6.8e-55

Best Hits

Swiss-Prot: 99% identical to OTC_RALPJ: Ornithine carbamoyltransferase (arcB) from Ralstonia pickettii (strain 12J)

KEGG orthology group: None (inferred from 99% identity to rpi:Rpic_2830)

MetaCyc: 44% identical to ornithine carbamoyltransferase (Arabidopsis thaliana col)
Ornithine carbamoyltransferase. [EC: 2.1.3.3]

Predicted SEED Role

"Ornithine carbamoyltransferase (EC 2.1.3.3)" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 2.1.3.3)

MetaCyc Pathways

• superpathway of arginine and polyamine biosynthesis (16/17 steps found)
• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-citrulline biosynthesis (7/8 steps found)
• L-citrulline degradation (3/3 steps found)
• L-arginine degradation XIII (reductive Stickland reaction) (4/5 steps found)
• urea cycle (4/5 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-arginine degradation V (arginine deiminase pathway) (3/4 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)
• L-arginine degradation XIV (oxidative Stickland reaction) (1/6 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.3

Protein Sequence (308 amino acids)

>ABZR87_RS00840 ornithine carbamoyltransferase (Ralstonia sp. UNC404CL21Col)
MNPPSSIKHYLQFKDFSLEEYEYLLDRSAILKAKFKNYETWHPLHDRTLAMIFEKNSTRT
RLSFEAGIHQLGGHAVFLNTRDSQLGRGEPIEDAAQVISRMTDIIMIRTFGQEIIERFAA
HSRVPVINGLTNEYHPCQVLADIFTFIEHRGPIKGKTVTWVGDANNMAYTWIQAAEILGF
RFHFSAPKGYQLDPAMVADSALPFVHVFESPLEACDGAHLVTTDVWTSMGYEAENEARKK
AFGDWMVTEAMMQRAQPDALFMHCLPAHRGEEVEAAVIDGKQSVVWDEAENRLHVQKALM
EYLLCGRY